Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NEIL3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8TAT5
Molecular weight:
33.75 kDa

Original price was: $264.00.Current price is: $230.00.

50ug 13% OFF + 230 loyalty points
Met1–Lys281
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NEIL3 Protein, N-His

Product name ARO-P10721-100
Uniprot ID Q8TAT5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVEGPGCTLNGEKIRARVLPGQAVTGVRGSALRSLQGRALRLAASTVVVSPQAAALNNDSSQNVLSLFNGYVYSGVETLGKELFMYFGPKALRIHFGMKGFIMINPLEYKYKNGASPVLEVQLTKDLICFFDSSVELRNSMESQQRIRMMKELDVCSPEFSFLRAESEVKKQKGRMLGDVLMDQNVLPGVGNIIKNEALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVCRFGDNNRMTYFCPHCQK
Molecular weight 33.75 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys281
Aliases /Synonyms DNA glycosylase FPG2, NEIL3, Endonuclease 8-like 3, Endonuclease VIII-like 3, Nei-like protein 3, DNA glycosylase/AP lyase Neil3
Reference ARO-P10721
Note For research use only.
Molecular Constructor
Met1–Lys281
Product name ARO-P10721-1MG
Uniprot ID Q8TAT5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVEGPGCTLNGEKIRARVLPGQAVTGVRGSALRSLQGRALRLAASTVVVSPQAAALNNDSSQNVLSLFNGYVYSGVETLGKELFMYFGPKALRIHFGMKGFIMINPLEYKYKNGASPVLEVQLTKDLICFFDSSVELRNSMESQQRIRMMKELDVCSPEFSFLRAESEVKKQKGRMLGDVLMDQNVLPGVGNIIKNEALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVCRFGDNNRMTYFCPHCQK
Molecular weight 33.75 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys281
Aliases /Synonyms DNA glycosylase FPG2, NEIL3, Endonuclease 8-like 3, Endonuclease VIII-like 3, Nei-like protein 3, DNA glycosylase/AP lyase Neil3
Reference ARO-P10721
Note For research use only.
Molecular Constructor
Met1–Lys281
Product name ARO-P10721-50
Uniprot ID Q8TAT5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVEGPGCTLNGEKIRARVLPGQAVTGVRGSALRSLQGRALRLAASTVVVSPQAAALNNDSSQNVLSLFNGYVYSGVETLGKELFMYFGPKALRIHFGMKGFIMINPLEYKYKNGASPVLEVQLTKDLICFFDSSVELRNSMESQQRIRMMKELDVCSPEFSFLRAESEVKKQKGRMLGDVLMDQNVLPGVGNIIKNEALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVCRFGDNNRMTYFCPHCQK
Molecular weight 33.75 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys281
Aliases /Synonyms DNA glycosylase FPG2, NEIL3, Endonuclease 8-like 3, Endonuclease VIII-like 3, Nei-like protein 3, DNA glycosylase/AP lyase Neil3
Reference ARO-P10721
Note For research use only.
Molecular Constructor
Met1–Lys281

Structure of Recombinant Human NEIL3 Protein

The Recombinant Human NEIL3 Protein is a protein that is produced through genetic engineering techniques, specifically recombinant DNA technology. It is a variant of the NEIL3 protein, which is a member of the base excision repair (BER) pathway that is involved in repairing damaged DNA. The NEIL3 protein is a 39 kDa protein that contains 354 amino acids. The recombinant version of this protein is produced in a laboratory setting and has the same amino acid sequence as the natural NEIL3 protein.

Activity of Recombinant Human NEIL3 Protein

The main activity of the Recombinant Human NEIL3 Protein is to repair damaged DNA through its role in the BER pathway. This pathway is responsible for repairing DNA damage caused by environmental factors such as UV radiation, chemicals, and oxidative stress. The NEIL3 protein specifically targets oxidative DNA damage, which is caused by reactive oxygen species (ROS). ROS can cause mutations in DNA, leading to various diseases including cancer.

The Recombinant Human NEIL3 Protein has a unique glycosylase activity, which allows it to recognize and remove damaged DNA bases. It specifically targets oxidized pyrimidines, such as thymine glycol and 5-hydroxyuracil, which are common types of oxidative DNA damage. The protein uses its glycosylase domain to remove the damaged base, and then the remaining gap is filled in by other enzymes in the BER pathway. This process ensures that the DNA is repaired correctly and prevents mutations from occurring.

Application of Recombinant Human NEIL3 Protein

The Recombinant Human NEIL3 Protein has various applications in the field of DNA repair and disease research. Its role in the BER pathway makes it an important protein for studying the mechanisms of DNA damage and repair. Researchers can use this protein to better understand how oxidative DNA damage contributes to diseases such as cancer and neurodegenerative disorders.

Additionally, the Recombinant Human NEIL3 Protein can be used in drug discovery and development. As oxidative DNA damage is linked to various diseases, targeting the NEIL3 protein could potentially lead to the development of new treatments. By studying the activity of the protein and its interaction with other enzymes in the BER pathway, researchers can identify potential drug targets and develop new therapies.

Furthermore, the Recombinant Human NEIL3 Protein can also be used as an antigen in diagnostic tests for diseases related to oxidative DNA damage. Antibodies against this protein can be used to detect its presence in patient samples, indicating the level of oxidative DNA damage and potential disease progression. This can aid in early detection and treatment of diseases.

Conclusion

The Recombinant Human NEIL3 Protein is a crucial protein in the BER pathway and plays a vital role in repairing oxidative DNA damage. Its unique glycosylase activity and structure make it an important target for research and potential drug development. By understanding the structure and activity of this protein, we can gain valuable insights into the mechanisms of DNA repair and its role in various diseases. The Recombinant Human NEIL3 Protein has multiple applications in the fields of research and medicine, making it a valuable tool for studying and treating diseases related to oxidative DNA damage.

Recombinant Human NEIL3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NEIL3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products