Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human COX4I2 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96KJ9
Molecular weight:
17.78 kDa

Original price was: $303.00.Current price is: $274.00.

50ug 10% OFF + 274 loyalty points
Thr55–Asn100
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human COX4I2 Protein, N-His-SUMO

Product name ARO-P11406-100
Uniprot ID Q96KJ9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSN
Molecular weight 17.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr55-Asn100
Aliases /Synonyms COX IV-2, Cytochrome c oxidase subunit 4 isoform 2, mitochondrial, COX4I2, Cytochrome c oxidase subunit IV isoform 2, COX4L2
Reference ARO-P11406
Note For research use only.
Molecular Constructor
Thr55–Asn100
Product name ARO-P11406-1MG
Uniprot ID Q96KJ9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSN
Molecular weight 17.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr55-Asn100
Aliases /Synonyms COX IV-2, Cytochrome c oxidase subunit 4 isoform 2, mitochondrial, COX4I2, Cytochrome c oxidase subunit IV isoform 2, COX4L2
Reference ARO-P11406
Note For research use only.
Molecular Constructor
Thr55–Asn100
Product name ARO-P11406-50
Uniprot ID Q96KJ9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSN
Molecular weight 17.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr55-Asn100
Aliases /Synonyms COX IV-2, Cytochrome c oxidase subunit 4 isoform 2, mitochondrial, COX4I2, Cytochrome c oxidase subunit IV isoform 2, COX4L2
Reference ARO-P11406
Note For research use only.
Molecular Constructor
Thr55–Asn100

Introduction

Recombinant Human COX4I2 Protein, also known as Cytochrome c oxidase subunit 4 isoform 2, is a protein that plays a crucial role in the electron transport chain and energy production in the mitochondria. It is a highly conserved protein that is found in all eukaryotic organisms and is essential for cellular metabolism and survival. In this article, we will discuss the structure, activity, and applications of this important protein.

Structure of Recombinant Human COX4I2 Protein

The COX4I2 gene is located on chromosome 20 in humans and is composed of 4 exons. The protein is composed of 140 amino acids and has a molecular weight of approximately 16 kDa. It consists of two transmembrane helices and a soluble domain that is exposed to the intermembrane space of the mitochondria. The soluble domain contains a highly conserved heme-binding motif, which is crucial for the function of the protein.

The crystal structure of Recombinant Human COX4I2 Protein has been determined, revealing a compact structure with a hydrophobic core and a highly flexible loop region. The two transmembrane helices are arranged in a perpendicular orientation, forming a V-shaped structure. The heme-binding motif is located at the tip of the loop region and is responsible for binding to the heme group in the cytochrome c oxidase complex.

Activity of Recombinant Human COX4I2 Protein

Recombinant Human COX4I2 Protein is a subunit of the cytochrome c oxidase complex, which is the final enzyme in the electron transport chain. This complex is responsible for the transfer of electrons from cytochrome c to oxygen, resulting in the production of ATP, the energy currency of the cell. COX4I2 specifically plays a crucial role in the assembly and stability of the complex, as well as in the regulation of its activity.

The heme-binding motif of COX4I2 is essential for its function, as it binds to the heme group in the cytochrome c oxidase complex, allowing for the transfer of electrons. Mutations in this motif have been associated with mitochondrial diseases, highlighting the importance of this protein in cellular metabolism and energy production.

Applications of Recombinant Human COX4I2 Protein

Recombinant Human COX4I2 Protein has various applications in both research and clinical settings. One of its main uses is in the study of mitochondrial diseases, as mutations in this protein have been linked to disorders such as Leigh syndrome and mitochondrial encephalomyopathy. By studying the structure and function of COX4I2, researchers can gain a better understanding of the underlying mechanisms of these diseases and potentially develop new treatments.

COX4I2 also has potential as a therapeutic target for cancer treatment. Studies have shown that targeting this protein can inhibit the growth and proliferation of cancer cells, making it a promising target for future drug development. Additionally, COX4I2 has been identified as a potential biomarker for certain types of cancer, allowing for early detection and improved treatment outcomes.

In the biotechnology industry, Recombinant Human COX4I2 Protein is used in the production of recombinant proteins. Its ability to regulate the activity of the cytochrome c oxidase complex makes it a valuable tool for optimizing cellular metabolism and protein production. It is also used in the development of new drugs and therapies that target mitochondrial function.

Conclusion

In summary, Recombinant Human COX4I2 Protein is a crucial component of the cytochrome c oxidase complex, playing a vital role in cellular energy production and metabolism. Its structure and function have been extensively studied, and it has various applications in both research and clinical settings. Further research on this protein may lead to new insights

Recombinant Human COX4I2 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human COX4I2 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products