Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RIOK3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O14730
Molecular weight:
33.69 kDa

Original price was: $376.00.Current price is: $327.00.

100ug 13% OFF + 327 loyalty points
Ser247–Glu519
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RIOK3 Protein, N-His

Product name ARO-P11623-100
Uniprot ID O14730
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SGMLETITGCISTGKESVVFHAYGGSMEDEKEDSKVIPTECAIKVFKTTLNEFKNRDKYIKDDFRFKDRFSKLNPRKIIRMWAEKEMHNLARMQRAGIPCPTVVLLKKHILVMSFIGHDQVPAPKLKEVKLNSEEMKEAYYQTLHLMRQLYHECTLVHADLSEYNMLWHAGKVWLIDVSQSVEPTHPHGLEFLFRDCRNVSQFFQKGGVKEALSERELFNAVSGLNITADNEADFLAEIEALEKMNEDHVQKNGRKAASFLKDDGDPPLLYDE
Molecular weight 33.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser247-Glu519
Aliases /Synonyms Serine/threonine-protein kinase RIO3, SUDD, sudD homolog, RIO kinase 3, RIOK3
Reference ARO-P11623
Note For research use only.
Molecular Constructor
Ser247–Glu519
Product name ARO-P11623-1MG
Uniprot ID O14730
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SGMLETITGCISTGKESVVFHAYGGSMEDEKEDSKVIPTECAIKVFKTTLNEFKNRDKYIKDDFRFKDRFSKLNPRKIIRMWAEKEMHNLARMQRAGIPCPTVVLLKKHILVMSFIGHDQVPAPKLKEVKLNSEEMKEAYYQTLHLMRQLYHECTLVHADLSEYNMLWHAGKVWLIDVSQSVEPTHPHGLEFLFRDCRNVSQFFQKGGVKEALSERELFNAVSGLNITADNEADFLAEIEALEKMNEDHVQKNGRKAASFLKDDGDPPLLYDE
Molecular weight 33.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser247-Glu519
Aliases /Synonyms Serine/threonine-protein kinase RIO3, SUDD, sudD homolog, RIO kinase 3, RIOK3
Reference ARO-P11623
Note For research use only.
Molecular Constructor
Ser247–Glu519
Product name ARO-P11623-50
Uniprot ID O14730
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SGMLETITGCISTGKESVVFHAYGGSMEDEKEDSKVIPTECAIKVFKTTLNEFKNRDKYIKDDFRFKDRFSKLNPRKIIRMWAEKEMHNLARMQRAGIPCPTVVLLKKHILVMSFIGHDQVPAPKLKEVKLNSEEMKEAYYQTLHLMRQLYHECTLVHADLSEYNMLWHAGKVWLIDVSQSVEPTHPHGLEFLFRDCRNVSQFFQKGGVKEALSERELFNAVSGLNITADNEADFLAEIEALEKMNEDHVQKNGRKAASFLKDDGDPPLLYDE
Molecular weight 33.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser247-Glu519
Aliases /Synonyms Serine/threonine-protein kinase RIO3, SUDD, sudD homolog, RIO kinase 3, RIOK3
Reference ARO-P11623
Note For research use only.
Molecular Constructor
Ser247–Glu519

Introduction

Recombinant Human RIOK3 Protein, also known as RIO kinase 3, is a key enzyme involved in the regulation of various cellular processes. It belongs to the RIO kinase family, which is a group of serine/threonine kinases that are highly conserved across different species. RIOK3 is involved in several important cellular pathways, making it a promising target for therapeutic interventions. In this article, we will discuss the structure, activity, and potential applications of Recombinant Human RIOK3 Protein.

Structure of Recombinant Human RIOK3 Protein

Recombinant Human RIOK3 Protein is a 58 kDa protein composed of 506 amino acids. It has a conserved kinase domain at the N-terminus, followed by a central region rich in proline and serine/threonine residues, and a C-terminal domain with a putative RNA-binding motif. The kinase domain is responsible for the catalytic activity of RIOK3, while the C-terminal domain is involved in substrate recognition and binding.

The crystal structure of RIOK3 has been determined, revealing a unique fold with a central beta-sheet surrounded by alpha-helices. This structure is similar to other RIO kinases, but RIOK3 has an extended loop region that is thought to be important for its substrate specificity. Recombinant Human RIOK3 Protein is produced through recombinant DNA technology, allowing for the production of large quantities of pure protein for research and therapeutic purposes.

Activity of Recombinant Human RIOK3 Protein

As a kinase, RIOK3 is involved in the phosphorylation of target proteins, thereby regulating their activity and function. It has been shown to phosphorylate several proteins involved in cell cycle regulation, RNA processing, and ribosome biogenesis. RIOK3 is also known to interact with other proteins and form complexes that play important roles in cellular processes.

One of the key functions of RIOK3 is its involvement in the regulation of cell cycle progression. It has been shown to phosphorylate the tumor suppressor protein p27, leading to its degradation and promoting cell cycle progression. RIOK3 has also been linked to the regulation of RNA processing, specifically in the maturation of ribosomal RNA. In addition, RIOK3 plays a role in the assembly of the large ribosomal subunit, further highlighting its importance in protein synthesis.

Applications of Recombinant Human RIOK3 Protein

Given its crucial role in various cellular processes, Recombinant Human RIOK3 Protein has potential applications in both research and therapeutic settings. In research, it can be used as a tool to study the functions of RIOK3 and its interactions with other proteins. It can also be used in biochemical assays to screen for potential inhibitors or activators of RIOK3.

In terms of therapeutics, RIOK3 has been identified as a potential target for the treatment of various diseases. For example, RIOK3 has been linked to the development and progression of certain types of cancer, making it a promising target for cancer therapy. In addition, RIOK3 has been implicated in neurodegenerative diseases, such as Alzheimer’s and Parkinson’s, suggesting its potential as a therapeutic target for these conditions.

Furthermore, Recombinant Human RIOK3 Protein can be used in the development of vaccines. RIOK3 has been identified as an antigen in several studies, and the use of recombinant RIOK3 protein in vaccine formulations has shown promising results in inducing an immune response against various diseases.

Conclusion

In summary, Recombinant Human RIOK3 Protein is a key enzyme involved in the regulation of various cellular processes. Its unique structure and activity make it an important target for research and therapeutic interventions. With further studies, the potential applications of RIOK3 in the treatment of diseases and the development of vaccines will continue to be explored.

Recombinant Human RIOK3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RIOK3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products