Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DZIP1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q86YF9
Molecular weight:
17.80 kDa

Original price was: $299.00.Current price is: $230.00.

50ug 23% OFF + 230 loyalty points
Ser66–Asp114
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DZIP1 Protein, N-His-SUMO

Product name ARO-P11397-100
Uniprot ID Q86YF9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVD
Molecular weight 17.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser66-Asp114
Aliases /Synonyms DAZ-interacting protein 1/2, DZIP1, Zinc finger protein DZIP1, DZIP, KIAA0996, DZIP2
Reference ARO-P11397
Note For research use only.
Molecular Constructor
Ser66–Asp114
Product name ARO-P11397-1MG
Uniprot ID Q86YF9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVD
Molecular weight 17.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser66-Asp114
Aliases /Synonyms DAZ-interacting protein 1/2, DZIP1, Zinc finger protein DZIP1, DZIP, KIAA0996, DZIP2
Reference ARO-P11397
Note For research use only.
Molecular Constructor
Ser66–Asp114
Product name ARO-P11397-50
Uniprot ID Q86YF9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVD
Molecular weight 17.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser66-Asp114
Aliases /Synonyms DAZ-interacting protein 1/2, DZIP1, Zinc finger protein DZIP1, DZIP, KIAA0996, DZIP2
Reference ARO-P11397
Note For research use only.
Molecular Constructor
Ser66–Asp114

Introduction

Recombinant proteins are proteins that are produced in a laboratory setting using genetic engineering techniques. These proteins are identical to their naturally occurring counterparts and have a wide range of applications in various fields, including medicine, biotechnology, and research. One such recombinant protein is the Recombinant Human DZIP1 Protein.

Structure of Recombinant Human DZIP1 Protein

The Recombinant Human DZIP1 Protein is a 175 kDa protein that is composed of 1531 amino acids. It is a member of the DAZ interacting protein (DZIP) family and is encoded by the DZIP1 gene located on chromosome 3p21.31. The protein has a conserved DZIP domain, which is responsible for its binding to DAZ (deleted in azoospermia) proteins. It also contains a C-terminal zinc finger domain, which is involved in protein-protein interactions.

Activity of Recombinant Human DZIP1 Protein

The main function of Recombinant Human DZIP1 Protein is to regulate the activity of DAZ proteins, which are essential for spermatogenesis and fertility. DAZ proteins are RNA-binding proteins that play a crucial role in the translation and stabilization of mRNAs involved in germ cell development. Recombinant Human DZIP1 Protein interacts with DAZ proteins and enhances their activity, thereby promoting proper germ cell development and male fertility.

Moreover, Recombinant Human DZIP1 Protein has been shown to have E3 ubiquitin ligase activity, which is the process of attaching ubiquitin molecules to target proteins for degradation. This activity is important for maintaining proper levels of proteins involved in various cellular processes, such as cell cycle regulation and DNA repair.

Application of Recombinant Human DZIP1 Protein

The unique structure and activity of Recombinant Human DZIP1 Protein make it a valuable tool in various applications, including research and medicine.

Research

Recombinant Human DZIP1 Protein has been extensively used in research studies to understand its role in spermatogenesis and male fertility. Its interaction with DAZ proteins and its ability to regulate their activity have been studied to gain insights into the molecular mechanisms of germ cell development. Furthermore, its E3 ubiquitin ligase activity has been investigated in relation to various cellular processes, such as cell cycle regulation and DNA repair.

Medicine

Recombinant Human DZIP1 Protein has potential therapeutic applications in the treatment of male infertility. Studies have shown that mutations in the DZIP1 gene can lead to abnormal sperm development and male infertility. Recombinant Human DZIP1 Protein can be used to supplement or enhance the activity of DAZ proteins, thereby improving sperm development and fertility in individuals with DZIP1 gene mutations.

In addition, the E3 ubiquitin ligase activity of Recombinant Human DZIP1 Protein can be utilized in cancer therapy. Aberrant expression of DZIP1 has been observed in various types of cancer, and its overexpression has been linked to tumor growth and progression. By targeting DZIP1 with Recombinant Human DZIP1 Protein, the levels of proteins involved in cancer growth and survival can be regulated, potentially leading to the development of new cancer treatments.

Conclusion

In summary, Recombinant Human DZIP1 Protein is a 175 kDa protein with a conserved DZIP domain and a C-terminal zinc finger domain. Its main function is to regulate the activity of DAZ proteins, which are essential for spermatogenesis and fertility. Additionally, it has E3 ubiquitin ligase activity, which has potential applications in cancer

Recombinant Human DZIP1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human DZIP1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products