Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human EP300, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q09472
Molecular weight:
16.27 kDa

Original price was: $299.00.Current price is: $230.00.

50ug 23% OFF + 230 loyalty points
His2283–His2414
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human EP300, N-His

Product name ARO-P12865-100
Uniprot ID Q09472
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH
Molecular weight 16.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His2283-His2414
Aliases /Synonyms Histone crotonyltransferase p300, Protein lactyltransferas p300, Protein propionyltransferase p300, Histone acetyltransferase p300, Protein 2-hydroxyisobutyryltransferase p300, EP300, p300 HAT, Histone butyryltransferase p300, P300, E1A-associated protein p300
Reference ARO-P12865
Note For research use only.
Molecular Constructor
His2283–His2414
Product name ARO-P12865-1MG
Uniprot ID Q09472
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH
Molecular weight 16.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His2283-His2414
Aliases /Synonyms Histone crotonyltransferase p300, Protein lactyltransferas p300, Protein propionyltransferase p300, Histone acetyltransferase p300, Protein 2-hydroxyisobutyryltransferase p300, EP300, p300 HAT, Histone butyryltransferase p300, P300, E1A-associated protein p300
Reference ARO-P12865
Note For research use only.
Molecular Constructor
His2283–His2414
Product name ARO-P12865-50
Uniprot ID Q09472
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH
Molecular weight 16.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His2283-His2414
Aliases /Synonyms Histone crotonyltransferase p300, Protein lactyltransferas p300, Protein propionyltransferase p300, Histone acetyltransferase p300, Protein 2-hydroxyisobutyryltransferase p300, EP300, p300 HAT, Histone butyryltransferase p300, P300, E1A-associated protein p300
Reference ARO-P12865
Note For research use only.
Molecular Constructor
His2283–His2414

Title: Introduction to Recombinant Human EP300

Recombinant Human EP300, also known as E1A-binding protein p300, is a highly conserved protein that plays a crucial role in various cellular processes such as transcription, DNA repair, and cell cycle regulation. It is a member of the p300/CBP family of histone acetyltransferases, which are enzymes involved in modifying the structure of chromatin and regulating gene expression. In this article, we will delve deeper into the structure, activity, and application of Recombinant Human EP300.

Title: Structure of Recombinant Human EP300

Recombinant Human EP300 is a large protein consisting of 2414 amino acids with a molecular weight of approximately 300 kDa. It contains several functional domains, including the N-terminal transactivation domain, the central catalytic domain, and the C-terminal domain. The N-terminal transactivation domain is responsible for interacting with transcription factors, while the central catalytic domain possesses histone acetyltransferase activity. The C-terminal domain is involved in protein-protein interactions and is essential for the stability of the protein.

Title: Activity of Recombinant Human EP300

The primary function of Recombinant Human EP300 is to acetylate lysine residues on histone proteins, thereby regulating the accessibility of DNA for transcription. This activity is crucial for the activation of gene expression and is regulated by various factors, including post-translational modifications and protein-protein interactions. Additionally, Recombinant Human EP300 has been shown to play a role in DNA repair by acetylating non-histone proteins involved in the DNA damage response. It also has a role in cell cycle regulation by acetylating proteins involved in cell cycle checkpoints.

Title: Applications of Recombinant Human EP300

Recombinant Human EP300 has a wide range of applications in both basic research and pharmaceutical development. Its ability to regulate gene expression makes it a valuable tool in studying various cellular processes, including development, differentiation, and disease progression. It is also used in drug discovery and development as a target for potential therapies. In addition, Recombinant Human EP300 has been implicated in various diseases, including cancer, neurodegenerative disorders, and metabolic disorders, making it a potential target for disease treatment.

Title: Recombinant Human EP300 as a Recombinant Protein

Recombinant Human EP300 is produced through recombinant DNA technology, which involves inserting the EP300 gene into a suitable expression system, such as bacteria or mammalian cells. This allows for the production of large quantities of pure and active EP300 protein, which can be used for various applications. Recombinant Human EP300 is also available as a purified protein for use in in vitro studies and assays.

Title: Recombinant Human EP300 as an Antigen

Due to its involvement in various diseases, Recombinant Human EP300 has also been studied as a potential antigen for vaccine development. Antigens are substances that can elicit an immune response, and EP300 has been shown to induce both humoral and cellular immune responses in animal models. This makes it a promising candidate for the development of therapeutic and prophylactic vaccines against diseases associated with EP300 dysregulation.

In conclusion, Recombinant Human EP300 is a multifunctional protein with a crucial role in various cellular processes. Its structure, activity, and applications make it a valuable tool in scientific research and a potential target for disease treatment and vaccine development. With ongoing studies and advancements in technology, the potential of Recombinant Human EP300 in various fields continues to expand, making it an exciting protein to study and utilize.

Recombinant Human EP300, N-His

There are no reviews yet.

Be the first to review “Recombinant Human EP300, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products