Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human UHRF1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96T88
Molecular weight:
29.27 kDa

Original price was: $292.00.Current price is: $230.00.

50ug 21% OFF + 230 loyalty points
Leu134–Asp366
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human UHRF1 Protein, N-His

Product name ARO-P12419-100
Uniprot ID Q96T88
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND
Molecular weight 29.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu134-Asp366
Aliases /Synonyms Nuclear zinc finger protein Np95, RING-type E3 ubiquitin transferase UHRF1, RING finger protein 106, Transcription factor ICBP90, E3 ubiquitin-protein ligase UHRF1, Ubiquitin-like PHD and RING finger domain-containing protein 1, NP95, HuNp95, Nuclear protein 95, RNF106, ICBP90, hNp95, UHRF1, Inverted CCAAT box-binding protein of 90 kDa, hUHRF1, Ubiquitin-like-containing PHD and RING finger domains protein 1
Reference ARO-P12419
Note For research use only.
Molecular Constructor
Leu134–Asp366
Product name ARO-P12419-1MG
Uniprot ID Q96T88
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND
Molecular weight 29.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu134-Asp366
Aliases /Synonyms Nuclear zinc finger protein Np95, RING-type E3 ubiquitin transferase UHRF1, RING finger protein 106, Transcription factor ICBP90, E3 ubiquitin-protein ligase UHRF1, Ubiquitin-like PHD and RING finger domain-containing protein 1, NP95, HuNp95, Nuclear protein 95, RNF106, ICBP90, hNp95, UHRF1, Inverted CCAAT box-binding protein of 90 kDa, hUHRF1, Ubiquitin-like-containing PHD and RING finger domains protein 1
Reference ARO-P12419
Note For research use only.
Molecular Constructor
Leu134–Asp366
Product name ARO-P12419-50
Uniprot ID Q96T88
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND
Molecular weight 29.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu134-Asp366
Aliases /Synonyms Nuclear zinc finger protein Np95, RING-type E3 ubiquitin transferase UHRF1, RING finger protein 106, Transcription factor ICBP90, E3 ubiquitin-protein ligase UHRF1, Ubiquitin-like PHD and RING finger domain-containing protein 1, NP95, HuNp95, Nuclear protein 95, RNF106, ICBP90, hNp95, UHRF1, Inverted CCAAT box-binding protein of 90 kDa, hUHRF1, Ubiquitin-like-containing PHD and RING finger domains protein 1
Reference ARO-P12419
Note For research use only.
Molecular Constructor
Leu134–Asp366

Introduction

Recombinant proteins have become essential tools in various fields of research, including molecular biology, biotechnology, and medicine. One such protein is the Recombinant Human UHRF1 Protein, which has gained significant attention in recent years due to its unique structure and diverse functions. In this article, we will explore the structure, activity, and application of this protein in detail.

Structure of Recombinant Human UHRF1 Protein

The Recombinant Human UHRF1 Protein is a 1052 amino acid protein with a molecular weight of approximately 120 kDa. It is encoded by the UHRF1 gene, located on chromosome 19 in humans. The protein consists of several functional domains, including a ubiquitin-like domain, a tandem tudor domain, a PHD domain, and a SET and RING-associated (SRA) domain. These domains play crucial roles in the protein’s activity and function.

Ubiquitin-like Domain

The ubiquitin-like domain of UHRF1 is responsible for its ability to bind to ubiquitin and other ubiquitin-like proteins. This domain is crucial for the protein’s role in epigenetic regulation and DNA repair.

Tandem Tudor Domain

The tandem tudor domain of UHRF1 is responsible for its interaction with methylated histones and DNA. This domain is essential for the protein’s role in chromatin remodeling and gene expression.

PHD Domain

The PHD domain of UHRF1 is responsible for its interaction with histone H3 and H4. This domain is crucial for the protein’s role in epigenetic regulation and DNA repair.

SRA Domain

The SRA domain of UHRF1 is responsible for its interaction with DNA and methylated DNA. This domain is essential for the protein’s role in maintaining DNA methylation patterns and gene expression.

Activity of Recombinant Human UHRF1 Protein

The Recombinant Human UHRF1 Protein has diverse activities, making it a multifunctional protein. Some of its key activities include:

Epigenetic Regulation

UHRF1 plays a crucial role in epigenetic regulation by maintaining DNA methylation patterns and promoting histone modifications. It does so by interacting with various enzymes and proteins involved in these processes, such as DNA methyltransferases and histone deacetylases.

DNA Repair

UHRF1 is also involved in DNA repair mechanisms, particularly in the repair of double-stranded DNA breaks. It does so by recruiting other proteins involved in DNA repair, such as BRCA1 and 53BP1, to the damaged sites.

Cell Cycle Regulation

UHRF1 is essential for proper cell cycle progression as it regulates the expression of genes involved in cell cycle checkpoints. It also plays a role in mitotic spindle formation and chromosome segregation during cell division.

Application of Recombinant Human UHRF1 Protein

The unique structure and diverse activities of Recombinant Human UHRF1 Protein make it a valuable tool in various research areas. Some of its applications include:

Epigenetic Research

UHRF1’s role in epigenetic regulation makes it a valuable protein for studying DNA methylation patterns and histone modifications. It can be used to investigate the mechanisms of epigenetic regulation and its role in various diseases, such as cancer.

Drug Development

UHRF1 has been identified as a potential target for drug development due to its involvement in

Recombinant Human UHRF1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human UHRF1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products