Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human EWSR1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q01844
Molecular weight:
22.71 kDa

Original price was: $409.00.Current price is: $327.00.

100ug 20% OFF + 327 loyalty points
Asp353–Arg446
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human EWSR1 Protein, N-His-SUMO

Product name ARO-P11973-100
Uniprot ID Q01844
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLAR
Molecular weight 22.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp353-Arg446
Aliases /Synonyms RNA-binding protein EWS, EWS oncogene, EWS, EWSR1, Ewing sarcoma breakpoint region 1 protein
Reference ARO-P11973
Note For research use only.
Molecular Constructor
Asp353–Arg446
Product name ARO-P11973-1MG
Uniprot ID Q01844
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLAR
Molecular weight 22.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp353-Arg446
Aliases /Synonyms RNA-binding protein EWS, EWS oncogene, EWS, EWSR1, Ewing sarcoma breakpoint region 1 protein
Reference ARO-P11973
Note For research use only.
Molecular Constructor
Asp353–Arg446
Product name ARO-P11973-50
Uniprot ID Q01844
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLAR
Molecular weight 22.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp353-Arg446
Aliases /Synonyms RNA-binding protein EWS, EWS oncogene, EWS, EWSR1, Ewing sarcoma breakpoint region 1 protein
Reference ARO-P11973
Note For research use only.
Molecular Constructor
Asp353–Arg446

Introduction

The field of biotechnology has revolutionized the way we produce and utilize proteins. Recombinant proteins, produced through genetic engineering techniques, have become essential tools in various scientific and medical applications. One such protein is the Recombinant Human EWSR1 Protein, which has gained significant attention in recent years due to its unique structure, activity, and potential applications.

Structure of Recombinant Human EWSR1 Protein

The EWSR1 gene, also known as EWS, encodes for the EWS RNA-binding protein 1. This protein is a member of the TET family of RNA-binding proteins and is involved in various cellular processes such as transcription, RNA processing, and DNA repair. The recombinant form of this protein is produced through the expression of the EWSR1 gene in a suitable host, such as bacteria or yeast, and subsequent purification.

The recombinant human EWSR1 protein has a molecular weight of approximately 68 kDa and is composed of 656 amino acids. It contains an N-terminal RNA recognition motif (RRM) and a C-terminal transactivation domain (TAD), both of which are crucial for its RNA-binding and transcriptional activities. The RRM domain is responsible for binding to specific RNA sequences, while the TAD domain interacts with other proteins to regulate gene expression.

Activity of Recombinant Human EWSR1 Protein

The main activity of the recombinant human EWSR1 protein is its ability to bind to RNA molecules and regulate gene expression. It has been shown to bind to a variety of RNA targets, including pre-mRNA, mRNA, and non-coding RNAs. This binding is essential for the proper processing and transport of RNA molecules, as well as for the regulation of gene expression at the transcriptional and post-transcriptional levels.

In addition to its RNA-binding activity, the recombinant human EWSR1 protein also plays a role in DNA repair. It has been shown to interact with DNA repair proteins and participate in the repair of DNA double-strand breaks. This activity is crucial for maintaining genomic stability and preventing the development of diseases such as cancer.

Applications of Recombinant Human EWSR1 Protein

The unique structure and activity of the recombinant human EWSR1 protein have made it a valuable tool in various scientific and medical applications. One of its main applications is in the study of RNA biology and gene expression. Its RNA-binding activity allows researchers to investigate the role of EWSR1 in RNA processing and transport, as well as its interactions with other proteins involved in these processes.

Another potential application of recombinant human EWSR1 protein is in cancer research and therapy. EWSR1 is known to be involved in the development of certain types of cancer, such as Ewing’s sarcoma. By studying the structure and activity of the recombinant protein, researchers can gain a better understanding of its role in cancer and potentially develop targeted therapies to treat these diseases.

Furthermore, the recombinant human EWSR1 protein has potential applications in biotechnology and drug discovery. Its RNA-binding activity can be utilized in high-throughput screening assays to identify compounds that can modulate its activity. This can lead to the development of new drugs targeting EWSR1 and other RNA-binding proteins.

Conclusion

The recombinant human EWSR1 protein is a versatile and essential tool in the field of biotechnology. Its unique structure and activity make it a valuable protein for studying RNA biology, gene expression, and DNA repair. Furthermore, its potential applications in cancer research and therapy

Recombinant Human EWSR1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human EWSR1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products