Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FGF16 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O43320
Molecular weight:
32.52 kDa

Original price was: $350.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Asn35–Arg207
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FGF16 Protein, N-His-SUMO

Product name ARO-P11539-100
Uniprot ID O43320
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Molecular weight 32.52 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn35-Arg207
Aliases /Synonyms FGF-16, Fibroblast growth factor 16, FGF16
Reference ARO-P11539
Note For research use only.
Molecular Constructor
Asn35–Arg207
Product name ARO-P11539-1MG
Uniprot ID O43320
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Molecular weight 32.52 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn35-Arg207
Aliases /Synonyms FGF-16, Fibroblast growth factor 16, FGF16
Reference ARO-P11539
Note For research use only.
Molecular Constructor
Asn35–Arg207
Product name ARO-P11539-50
Uniprot ID O43320
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Molecular weight 32.52 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn35-Arg207
Aliases /Synonyms FGF-16, Fibroblast growth factor 16, FGF16
Reference ARO-P11539
Note For research use only.
Molecular Constructor
Asn35–Arg207

Introduction

Recombinant Human FGF16 Protein is a type of recombinant protein that has been engineered through genetic manipulation to mimic the structure and function of the human fibroblast growth factor 16 (FGF16) protein. This protein plays a crucial role in various biological processes, making it a valuable tool in scientific research and potential therapeutic applications. In this article, we will explore the structure, activity, and potential applications of Recombinant Human FGF16 Protein.

Structure of Recombinant Human FGF16 Protein

Recombinant Human FGF16 Protein is a 21-kDa protein consisting of 192 amino acids. It shares a high degree of sequence similarity with other members of the FGF family, particularly with FGF2 and FGF9. The protein has a conserved core region, which is responsible for its biological activity, and a variable N-terminal region, which determines its specificity for different receptors.

The crystal structure of Recombinant Human FGF16 Protein has been determined, revealing a compact globular structure with 12 beta strands and 6 alpha helices. The protein also contains two disulfide bonds, which are essential for its stability and activity.

Activity of Recombinant Human FGF16 Protein

Recombinant Human FGF16 Protein is a potent mitogen, meaning it stimulates cell division and proliferation. It exerts its effects by binding to specific cell surface receptors, known as FGF receptors (FGFRs). These receptors are present on the surface of various cell types, including epithelial, endothelial, and mesenchymal cells.

Upon binding to FGFRs, Recombinant Human FGF16 Protein triggers a cascade of signaling events that ultimately lead to cell growth, survival, and differentiation. It also plays a role in angiogenesis, the process of forming new blood vessels, by stimulating the proliferation of endothelial cells.

In addition to its mitogenic activity, Recombinant Human FGF16 Protein has been shown to have neurotrophic and neuroprotective effects. It promotes the survival and differentiation of neurons, making it a potential therapeutic agent for neurodegenerative diseases.

Applications of Recombinant Human FGF16 Protein

Recombinant Human FGF16 Protein has a wide range of applications in scientific research and potential therapeutic use. Here are some of its most notable applications:

1. Cell Culture Studies

Recombinant Human FGF16 Protein is commonly used in cell culture studies to investigate its effects on cell growth, survival, and differentiation. It is also used to study the signaling pathways activated by FGF16 and its interactions with other growth factors and cytokines.

2. Tissue Engineering

Due to its mitogenic and angiogenic properties, Recombinant Human FGF16 Protein has been explored as a potential growth factor for tissue engineering applications. It has been shown to promote the proliferation and differentiation of various cell types, including stem cells, making it a promising candidate for tissue regeneration.

3. Wound Healing

Recombinant Human FGF16 Protein has been investigated for its potential in promoting wound healing. It has been shown to accelerate the healing process by stimulating the proliferation of epithelial cells and the formation of new blood vessels.

4. Neurodegenerative Diseases

As mentioned earlier, Recombinant Human FGF16 Protein has neurotrophic and neuroprotective effects, making it a potential therapeutic agent for neurodegenerative diseases such as Alzheimer’s and Parkinson’s. It has been shown to promote neuronal survival and differentiation, and further research is being conducted to explore its potential in treating these diseases.

5. Cancer Research

Aberrant FGF signaling has been linked to various types of cancer, making Recombinant Human FGF16 Protein a valuable tool in cancer research. It has been used to investigate the role of FGF16 in cancer development and progression and to develop potential targeted therapies.

<h2

Recombinant Human FGF16 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human FGF16 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products