Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human FGF16 Protein, None

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O43320
Molecular weight:
20.41KDa

Original price was: $334.00.Current price is: $274.00.

50ug 18% OFF + 274 loyalty points
Asn35–Arg207
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human FGF16 Protein, None

Recombinant Human FGF16 Protein, None

Product name ARO-P10412-100
Uniprot ID O43320
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Molecular weight 20.41KDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn35-Arg207
Aliases /Synonyms FGF-16, Fibroblast growth factor 16, FGF16
Reference ARO-P10412
Note For research use only.
Molecular Constructor
Asn35–Arg207
Product name ARO-P10412-1MG
Uniprot ID O43320
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Molecular weight 20.41KDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn35-Arg207
Aliases /Synonyms FGF-16, Fibroblast growth factor 16, FGF16
Reference ARO-P10412
Note For research use only.
Molecular Constructor
Asn35–Arg207
Product name ARO-P10412-50
Uniprot ID O43320
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Molecular weight 20.41KDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn35-Arg207
Aliases /Synonyms FGF-16, Fibroblast growth factor 16, FGF16
Reference ARO-P10412
Note For research use only.
Molecular Constructor
Asn35–Arg207

Recombinant Human FGF16 Protein, None

There are no reviews yet.

Be the first to review “Recombinant Human FGF16 Protein, None”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products