Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FLCN Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8NFG4
Molecular weight:
28.46 kDa

Original price was: $345.00.Current price is: $274.00.

50ug 21% OFF + 274 loyalty points
Lys347–Asn579
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FLCN Protein, N-His

Product name ARO-P11702-100
Uniprot ID Q8NFG4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KSLRHMRQVLGAPSFRMLAWHVLMGNQVIWKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGLSPHVQIPPHVLSSEFAVIVEVHAAARSTLHPVGCEDDQSLSKYEFVVTSGSPVAADRVGPTILNKIEAALTNQNLSVDVVDQCLVCLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMTGLSKTYKSHLMSTVRSPTASESRN
Molecular weight 28.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys347-Asn579
Aliases /Synonyms BHD skin lesion fibrofolliculoma protein, FLCN, Birt-Hogg-Dube syndrome protein, BHD, Folliculin
Reference ARO-P11702
Note For research use only.
Molecular Constructor
Lys347–Asn579
Product name ARO-P11702-1MG
Uniprot ID Q8NFG4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KSLRHMRQVLGAPSFRMLAWHVLMGNQVIWKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGLSPHVQIPPHVLSSEFAVIVEVHAAARSTLHPVGCEDDQSLSKYEFVVTSGSPVAADRVGPTILNKIEAALTNQNLSVDVVDQCLVCLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMTGLSKTYKSHLMSTVRSPTASESRN
Molecular weight 28.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys347-Asn579
Aliases /Synonyms BHD skin lesion fibrofolliculoma protein, FLCN, Birt-Hogg-Dube syndrome protein, BHD, Folliculin
Reference ARO-P11702
Note For research use only.
Molecular Constructor
Lys347–Asn579
Product name ARO-P11702-50
Uniprot ID Q8NFG4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KSLRHMRQVLGAPSFRMLAWHVLMGNQVIWKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGLSPHVQIPPHVLSSEFAVIVEVHAAARSTLHPVGCEDDQSLSKYEFVVTSGSPVAADRVGPTILNKIEAALTNQNLSVDVVDQCLVCLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMTGLSKTYKSHLMSTVRSPTASESRN
Molecular weight 28.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys347-Asn579
Aliases /Synonyms BHD skin lesion fibrofolliculoma protein, FLCN, Birt-Hogg-Dube syndrome protein, BHD, Folliculin
Reference ARO-P11702
Note For research use only.
Molecular Constructor
Lys347–Asn579

Title: Introduction to Recombinant Human FLCN Protein

Recombinant Human FLCN Protein, also known as Folliculin, is a protein that is encoded by the FLCN gene. This gene is located on chromosome 17 and is responsible for the production of the Folliculin protein. Recombinant Human FLCN Protein is a highly conserved protein that is found in many organisms, including humans. It plays a crucial role in various cellular processes and has been the subject of extensive research in recent years.

Structure of Recombinant Human FLCN Protein

The Recombinant Human FLCN Protein is composed of 579 amino acids and has a molecular weight of approximately 64 kDa. It is a large protein with a complex structure, consisting of multiple domains and regions. The N-terminal region of the protein contains a conserved domain known as the DENN domain, which is responsible for its interaction with other proteins. The C-terminal region of the protein contains a region called the FNIP domain, which is involved in the regulation of cellular metabolism.

Activity of Recombinant Human FLCN Protein

The primary function of Recombinant Human FLCN Protein is to act as a tumor suppressor. It is involved in the regulation of cell growth, proliferation, and survival. Studies have shown that mutations in the FLCN gene can lead to the development of Birt-Hogg-Dubé syndrome, a rare genetic disorder characterized by the formation of tumors in various organs, including the skin, lungs, and kidneys. This highlights the crucial role of Recombinant Human FLCN Protein in maintaining cellular homeostasis and preventing the development of tumors.

In addition to its role as a tumor suppressor, Recombinant Human FLCN Protein has been found to be involved in other cellular processes, such as autophagy and cellular signaling. It has been shown to interact with various proteins, including AMP-activated protein kinase (AMPK), mTORC1, and Rheb, and regulate their activity. This suggests that Recombinant Human FLCN Protein plays a crucial role in the regulation of cellular metabolism and energy homeostasis.

Application of Recombinant Human FLCN Protein

Recombinant Human FLCN Protein has a wide range of potential applications in both research and clinical settings. Its role as a tumor suppressor makes it a promising target for the development of new cancer therapies. By understanding the structure and function of Recombinant Human FLCN Protein, researchers can identify potential inhibitors or activators that can modulate its activity and potentially treat Birt-Hogg-Dubé syndrome and other diseases associated with FLCN mutations.

In addition, Recombinant Human FLCN Protein can also be used as an antigen in immunological studies. Its highly conserved nature makes it an ideal candidate for generating antibodies that can be used to detect and study its expression and activity in different tissues and cell types. These antibodies can also be used in diagnostic tests for Birt-Hogg-Dubé syndrome and other diseases associated with FLCN mutations.

Conclusion

In summary, Recombinant Human FLCN Protein is a highly conserved protein that plays a crucial role in various cellular processes, including tumor suppression, autophagy, and cellular signaling. Its structure and activity have been extensively studied, and it has shown potential as a therapeutic target and antigen in immunological studies. Further research on Recombinant Human FLCN Protein will undoubtedly provide valuable insights into its role in maintaining cellular homeostasis and its potential applications in various fields.

Recombinant Human FLCN Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FLCN Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products