Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FNDC1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q4ZHG4
Molecular weight:
27.62 kDa

Original price was: $396.00.Current price is: $327.00.

100ug 17% OFF + 327 loyalty points
Ala33–Asp258
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FNDC1 Protein, N-His

Product name ARO-P12653-100
Uniprot ID Q4ZHG4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAASVDHPLKPRHVKLLSTKMGLKVTWDPPKDATSRPVEHYNIAYGKSLKSLKYIKVNAETYSFLIEDVEPGVVYFVLLTAENHSGVSRPVYRAESPPGGEWIEIDGFPIKGPGPFNETVTEKEVPNKPLRVRVRSSDDRLSVAWKAPRLSGAKSPRRSRGFLLGYGESGRKMNYVPLTRDERTHEIKKLASESVYVVSLQSMNSQGRSQPVYRAALTKRKISEED
Molecular weight 27.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala33-Asp258
Aliases /Synonyms KIAA1866, Expressed in synovial lining protein, MEL4B3, FNDC2, FNDC1, Activation-associated cDNA protein, Fibronectin type III domain-containing protein 1
Reference ARO-P12653
Note For research use only.
Molecular Constructor
Ala33–Asp258
Product name ARO-P12653-1MG
Uniprot ID Q4ZHG4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAASVDHPLKPRHVKLLSTKMGLKVTWDPPKDATSRPVEHYNIAYGKSLKSLKYIKVNAETYSFLIEDVEPGVVYFVLLTAENHSGVSRPVYRAESPPGGEWIEIDGFPIKGPGPFNETVTEKEVPNKPLRVRVRSSDDRLSVAWKAPRLSGAKSPRRSRGFLLGYGESGRKMNYVPLTRDERTHEIKKLASESVYVVSLQSMNSQGRSQPVYRAALTKRKISEED
Molecular weight 27.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala33-Asp258
Aliases /Synonyms KIAA1866, Expressed in synovial lining protein, MEL4B3, FNDC2, FNDC1, Activation-associated cDNA protein, Fibronectin type III domain-containing protein 1
Reference ARO-P12653
Note For research use only.
Molecular Constructor
Ala33–Asp258
Product name ARO-P12653-50
Uniprot ID Q4ZHG4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAASVDHPLKPRHVKLLSTKMGLKVTWDPPKDATSRPVEHYNIAYGKSLKSLKYIKVNAETYSFLIEDVEPGVVYFVLLTAENHSGVSRPVYRAESPPGGEWIEIDGFPIKGPGPFNETVTEKEVPNKPLRVRVRSSDDRLSVAWKAPRLSGAKSPRRSRGFLLGYGESGRKMNYVPLTRDERTHEIKKLASESVYVVSLQSMNSQGRSQPVYRAALTKRKISEED
Molecular weight 27.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala33-Asp258
Aliases /Synonyms KIAA1866, Expressed in synovial lining protein, MEL4B3, FNDC2, FNDC1, Activation-associated cDNA protein, Fibronectin type III domain-containing protein 1
Reference ARO-P12653
Note For research use only.
Molecular Constructor
Ala33–Asp258

Title: Introduction to Recombinant Human FNDC1 Protein

Recombinant Human FNDC1 Protein, also known as Fibronectin type III domain-containing protein 1, is a human protein that plays a crucial role in cell adhesion, migration, and proliferation. This protein is encoded by the FNDC1 gene and is a member of the fibronectin type III domain-containing protein family. FNDC1 protein contains three fibronectin type III domains, which are important for protein-protein interactions. In this article, we will discuss the structure, activity, and application of Recombinant Human FNDC1 Protein.

Title: Structure of Recombinant Human FNDC1 Protein

Recombinant Human FNDC1 Protein is a 33 kDa protein that is composed of 299 amino acids. It contains three fibronectin type III domains, which are connected by flexible linker regions. These domains are responsible for the protein’s ability to interact with other proteins and play a role in cell adhesion. The first domain is the N-terminal domain, which is responsible for binding to integrin receptors. The second and third domains are involved in binding to other extracellular matrix proteins, such as collagen and fibronectin. The structure of FNDC1 protein is essential for its function in cell adhesion and migration.

Title: Activity of Recombinant Human FNDC1 Protein

Recombinant Human FNDC1 Protein is involved in various cellular processes, including cell adhesion, migration, and proliferation. It plays a crucial role in the formation of focal adhesions, which are structures that connect the cell to the extracellular matrix. FNDC1 protein binds to integrin receptors on the cell surface, which triggers the formation of focal adhesions. These structures are essential for cell adhesion and migration, as well as for signaling pathways that regulate cell growth and survival. FNDC1 protein also interacts with other extracellular matrix proteins, such as collagen and fibronectin, to promote cell adhesion and migration.

Title: Application of Recombinant Human FNDC1 Protein

Recombinant Human FNDC1 Protein has various applications in the field of cell biology and biotechnology. It is commonly used as an antigen in research studies to study its role in cell adhesion and migration. FNDC1 protein can also be used as a coating protein in cell culture experiments to promote cell adhesion and proliferation. In addition, FNDC1 protein has potential therapeutic applications in tissue engineering and regenerative medicine. It can be used as a biomaterial to promote cell adhesion and tissue regeneration in damaged tissues.

Title: Recombinant Human FNDC1 Protein as an Antigen

Recombinant Human FNDC1 Protein is widely used as an antigen in research studies. It can be used to generate antibodies that specifically bind to FNDC1 protein and can be used for various applications, such as Western blotting, immunofluorescence, and immunohistochemistry. These antibodies can also be used to study the expression and localization of FNDC1 protein in different cell types and tissues. Furthermore, the use of recombinant FNDC1 protein as an antigen allows for the production of large quantities of protein, making it a cost-effective option for research studies.

Title: Conclusion

In conclusion, Recombinant Human FNDC1 Protein is an important protein that plays a crucial role in cell adhesion, migration, and proliferation. Its structure, with three fibronectin type III domains, is essential for its function in cell adhesion and interaction with other proteins. FNDC1 protein has various applications in cell biology and biotechnology, including its use as an antigen for research studies. Further research on this protein may lead to potential therapeutic applications in tissue engineering and regenerative medicine.

Recombinant Human FNDC1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FNDC1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products