Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FZR1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UM11
Molecular weight:
38.25 kDa

Original price was: $361.00.Current price is: $327.00.

100ug 9% OFF + 327 loyalty points
Ser172–Arg496
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FZR1 Protein, N-His

Product name ARO-P12236-100
Uniprot ID Q9UM11
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKVKWESVSVLNLFTRIR
Molecular weight 38.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser172-Arg496
Aliases /Synonyms FZR, hCDH1, Fizzy-related protein homolog, Cdh1/Hct1 homolog, Fzr, CDH1, CDC20-like protein 1, KIAA1242, FYR, FZR1
Reference ARO-P12236
Note For research use only.
Molecular Constructor
Ser172–Arg496
Product name ARO-P12236-1MG
Uniprot ID Q9UM11
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKVKWESVSVLNLFTRIR
Molecular weight 38.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser172-Arg496
Aliases /Synonyms FZR, hCDH1, Fizzy-related protein homolog, Cdh1/Hct1 homolog, Fzr, CDH1, CDC20-like protein 1, KIAA1242, FYR, FZR1
Reference ARO-P12236
Note For research use only.
Molecular Constructor
Ser172–Arg496
Product name ARO-P12236-50
Uniprot ID Q9UM11
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKVKWESVSVLNLFTRIR
Molecular weight 38.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser172-Arg496
Aliases /Synonyms FZR, hCDH1, Fizzy-related protein homolog, Cdh1/Hct1 homolog, Fzr, CDH1, CDC20-like protein 1, KIAA1242, FYR, FZR1
Reference ARO-P12236
Note For research use only.
Molecular Constructor
Ser172–Arg496

Introduction

Recombinant proteins are proteins that are produced in a laboratory setting using genetic engineering techniques. These proteins have a wide range of applications in various fields, including medicine, biotechnology, and research. One such protein is Recombinant Human FZR1 Protein, which has gained significant attention due to its unique structure and diverse functions. In this article, we will explore the structure, activity, and applications of this protein in detail.

Structure of Recombinant Human FZR1 Protein

Recombinant Human FZR1 Protein, also known as Fizzy-related protein homolog, is a member of the F-box protein family. It is encoded by the FZR1 gene located on chromosome 19 in humans. This protein is composed of 654 amino acids and has a molecular weight of approximately 73 kDa.

The primary structure of Recombinant Human FZR1 Protein consists of an N-terminal F-box domain, a central WD40 repeat domain, and a C-terminal domain. The F-box domain is responsible for binding to the Skp1-Cullin-F-box (SCF) complex, which is involved in protein degradation. The WD40 repeat domain is responsible for protein-protein interactions, while the C-terminal domain is involved in substrate recognition.

Activity of Recombinant Human FZR1 Protein

Recombinant Human FZR1 Protein plays a crucial role in cell cycle regulation. It acts as a substrate recognition component of the anaphase-promoting complex/cyclosome (APC/C), which is responsible for the degradation of cell cycle regulators. FZR1 specifically targets proteins such as Cyclin B and securin for degradation, which are essential for the progression of the cell cycle.

In addition to its role in cell cycle regulation, Recombinant Human FZR1 Protein has also been found to be involved in other cellular processes, including DNA damage response, apoptosis, and cellular differentiation. It has been shown to interact with various proteins and regulate their functions, making it a crucial player in maintaining cellular homeostasis.

Applications of Recombinant Human FZR1 Protein

The unique structure and activity of Recombinant Human FZR1 Protein make it a valuable tool in various research fields. One of its primary applications is in studying the cell cycle and its regulation. By targeting specific substrates for degradation, this protein can provide insights into the mechanisms of cell cycle progression and its dysregulation in diseases such as cancer.

Recombinant Human FZR1 Protein has also been used in drug discovery and development. Its role in cell cycle regulation makes it a potential target for therapeutic interventions in diseases where cell proliferation is abnormal. Researchers are also exploring its potential as a biomarker for certain types of cancer, which could aid in early detection and treatment.

Moreover, the use of Recombinant Human FZR1 Protein in biotechnology has shown promising results. It has been used in the production of recombinant proteins, as well as in the development of transgenic organisms. Its ability to regulate protein degradation can be harnessed for the production of specific proteins in large quantities, making it a valuable tool in biomanufacturing processes.

Conclusion

In summary, Recombinant Human FZR1 Protein is a versatile protein with a unique structure and diverse functions. Its role in cell cycle regulation and other cellular processes make it an essential player in maintaining cellular homeostasis. Its applications in research, drug discovery, and biotechnology make it a valuable tool for understanding and manipulating cellular processes. Further studies on this protein could potentially lead to new therapeutic strategies and advancements in biotechnology.</

Recombinant Human FZR1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FZR1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products