Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GDF7, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q7Z4P5
Molecular weight:
16.32 kDa

Original price was: $280.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Thr322–Arg450
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GDF7, N-His

Product name ARO-P13274-100
Uniprot ID Q7Z4P5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
Molecular weight 16.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr322-Arg450
Aliases /Synonyms Growth/differentiation factor 7, GDF-7, GDF7
Reference ARO-P13274
Note For research use only.
Molecular Constructor
Thr322–Arg450
Product name ARO-P13274-1MG
Uniprot ID Q7Z4P5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
Molecular weight 16.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr322-Arg450
Aliases /Synonyms Growth/differentiation factor 7, GDF-7, GDF7
Reference ARO-P13274
Note For research use only.
Molecular Constructor
Thr322–Arg450
Product name ARO-P13274-50
Uniprot ID Q7Z4P5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
Molecular weight 16.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr322-Arg450
Aliases /Synonyms Growth/differentiation factor 7, GDF-7, GDF7
Reference ARO-P13274
Note For research use only.
Molecular Constructor
Thr322–Arg450

Introduction to Recombinant Human GDF7

Recombinant Human GDF7 (Growth and Differentiation Factor 7) is a protein that belongs to the Transforming Growth Factor beta (TGF-β) superfamily. It is a homodimer consisting of two identical subunits, each containing 120 amino acids. GDF7 is produced by recombinant DNA technology and has a molecular weight of approximately 27 kDa. This protein plays a crucial role in regulating cell growth, differentiation, and development in various tissues and organs.

Structure of Recombinant Human GDF7

The structure of recombinant human GDF7 is similar to other members of the TGF-β superfamily, with a characteristic cystine knot fold. It consists of an N-terminal propeptide region, a mature domain, and a C-terminal region. The mature domain is responsible for the biological activity of the protein and is highly conserved among different species. The cystine knot fold is formed by six conserved cysteine residues that are crucial for maintaining the structural integrity of the protein.

Activity of Recombinant Human GDF7

Recombinant Human GDF7 has been shown to have diverse biological activities in different cell types and tissues. It acts as a potent regulator of cell growth and differentiation by interacting with specific receptors on the cell surface. GDF7 can activate both the canonical and non-canonical signaling pathways, leading to the activation of downstream target genes.

One of the major activities of GDF7 is its role in bone formation and regeneration. It has been shown to stimulate the proliferation and differentiation of osteoblasts, the cells responsible for bone formation. GDF7 also promotes the synthesis of extracellular matrix proteins, such as collagen and osteocalcin, which are essential for bone mineralization.

In addition to its role in bone formation, recombinant human GDF7 has also been implicated in cartilage development and repair. It can induce the differentiation of chondrocytes, the cells responsible for cartilage formation, and stimulate the production of cartilage-specific extracellular matrix proteins.

GDF7 also plays a critical role in the development and maintenance of the nervous system. It has been shown to promote the survival and differentiation of neurons, as well as the formation of synapses between neurons. This protein also has neuroprotective effects and has been studied for its potential therapeutic use in neurodegenerative diseases.

Applications of Recombinant Human GDF7

Due to its diverse biological activities, recombinant human GDF7 has a wide range of potential applications in the field of biomedicine. One of the most promising applications is in bone and cartilage tissue engineering. GDF7 can be incorporated into scaffolds or used in combination with other growth factors to promote the formation of functional bone and cartilage tissues.

Another potential application of recombinant human GDF7 is in the treatment of bone and joint disorders, such as osteoporosis and osteoarthritis. It has been shown to have anabolic effects on bone and cartilage, making it a potential therapeutic agent for these conditions.

In addition, GDF7 has been studied for its potential use in nerve regeneration and repair. Its ability to promote neuronal survival and differentiation makes it a promising candidate for the treatment of nerve injuries and neurodegenerative diseases.

Conclusion

In summary, recombinant human GDF7 is a versatile protein with diverse biological activities. Its structure, activity, and potential applications make it a promising candidate for various biomedical applications, particularly in the fields of bone and cartilage tissue engineering, as well as nerve regeneration and repair. Further research and development of this protein could lead to new and improved treatments for a range of diseases and injuries.

Recombinant Human GDF7, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GDF7, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products