Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GPT2, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8TD30
Molecular weight:
41.35 kDa

Original price was: $419.00.Current price is: $327.00.

100ug 22% OFF + 327 loyalty points
Val174–Ala523
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GPT2, N-His

Product name ARO-P13226-100
Uniprot ID Q8TD30
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VPADPDNIYLTTGASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKYA
Molecular weight 41.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val174-Ala523
Aliases /Synonyms Alanine aminotransferase 2, Glutamic--pyruvic transaminase 2, AAT2, ALT2, Glutamate pyruvate transaminase 2, GPT 2, Glutamic--alanine transaminase 2, GPT2
Reference ARO-P13226
Note For research use only.
Molecular Constructor
Val174–Ala523
Product name ARO-P13226-1MG
Uniprot ID Q8TD30
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VPADPDNIYLTTGASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKYA
Molecular weight 41.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val174-Ala523
Aliases /Synonyms Alanine aminotransferase 2, Glutamic--pyruvic transaminase 2, AAT2, ALT2, Glutamate pyruvate transaminase 2, GPT 2, Glutamic--alanine transaminase 2, GPT2
Reference ARO-P13226
Note For research use only.
Molecular Constructor
Val174–Ala523
Product name ARO-P13226-50
Uniprot ID Q8TD30
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VPADPDNIYLTTGASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKYA
Molecular weight 41.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val174-Ala523
Aliases /Synonyms Alanine aminotransferase 2, Glutamic--pyruvic transaminase 2, AAT2, ALT2, Glutamate pyruvate transaminase 2, GPT 2, Glutamic--alanine transaminase 2, GPT2
Reference ARO-P13226
Note For research use only.
Molecular Constructor
Val174–Ala523

Introduction to Recombinant Human GPT2

Recombinant Human GPT2 is a protein that has been produced using recombinant DNA technology. This technology involves inserting a specific gene into a host organism, such as bacteria or yeast, to produce large amounts of a desired protein. In the case of Recombinant Human GPT2, the gene for this protein is inserted into a host organism and then grown in large quantities, allowing for the production of a highly pure and specific protein.

Structure of Recombinant Human GPT2

Recombinant Human GPT2 is a member of the glutamate pyruvate transaminase family of proteins. It is composed of 444 amino acids and has a molecular weight of approximately 50 kDa. The protein has a three-dimensional structure that consists of two domains, an N-terminal domain and a C-terminal domain, connected by a flexible linker region. The N-terminal domain contains the active site of the protein, while the C-terminal domain is involved in protein-protein interactions.

Activity of Recombinant Human GPT2

Recombinant Human GPT2 is an enzyme that plays a crucial role in the metabolism of amino acids. Specifically, it catalyzes the reversible conversion of glutamate and pyruvate to alpha-ketoglutarate and alanine. This reaction is important for maintaining the balance of amino acids in the body and is essential for the proper functioning of various organs, including the liver, brain, and muscles.

The activity of Recombinant Human GPT2 is highly specific, meaning it only acts on a specific substrate, glutamate, and produces a specific product, alpha-ketoglutarate. This specificity is crucial for the proper functioning of the enzyme and ensures that it does not interfere with other metabolic processes in the body.

Applications of Recombinant Human GPT2

The high specificity and activity of Recombinant Human GPT2 make it a valuable tool in various fields, including research, diagnostics, and biotechnology.

In research, Recombinant Human GPT2 is used to study the role of this enzyme in various diseases and conditions. For example, studies have shown that changes in the activity of GPT2 are associated with liver diseases, such as non-alcoholic fatty liver disease and liver cancer. By using Recombinant Human GPT2, researchers can better understand the mechanisms underlying these diseases and develop potential treatments.

In diagnostics, Recombinant Human GPT2 is used as a biomarker for liver damage. Elevated levels of this enzyme in the blood can indicate liver injury, making it a useful tool for diagnosing and monitoring liver diseases.

In biotechnology, Recombinant Human GPT2 is used for the production of alpha-ketoglutarate, an important compound used in the production of antibiotics, food additives, and other industrial products. The high specificity and activity of this enzyme make it a cost-effective and efficient tool for the large-scale production of alpha-ketoglutarate.

Conclusion

In summary, Recombinant Human GPT2 is a highly specific and active enzyme that plays a crucial role in the metabolism of amino acids. Its structure and activity make it a valuable tool in various fields, including research, diagnostics, and biotechnology. As more studies are conducted and its applications are expanded, Recombinant Human GPT2 will continue to play an important role in advancing our understanding of human health and disease.

Recombinant Human GPT2, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GPT2, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products