Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human HSPBP1, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NZL4
Molecular weight:
51.45 kDa

Original price was: $370.00.Current price is: $327.00.

100ug 12% OFF + 327 loyalty points
Asn133–Ser351
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human HSPBP1, N-GST

Recombinant Human HSPBP1, N-GST

Product name ARO-P13047-100
Uniprot ID Q9NZL4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSS
Molecular weight 51.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn133-Ser351
Aliases /Synonyms Hsp70-binding protein 2, Hsp70-interacting protein 1, Hsp70-interacting protein 2, HSPBP, HspBP2, Hsp70-binding protein 1, HSPBP1, Heat shock protein-binding protein 1, HspBP1
Reference ARO-P13047
Note For research use only.
Molecular Constructor
Asn133–Ser351
Product name ARO-P13047-1MG
Uniprot ID Q9NZL4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSS
Molecular weight 51.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn133-Ser351
Aliases /Synonyms Hsp70-binding protein 2, Hsp70-interacting protein 1, Hsp70-interacting protein 2, HSPBP, HspBP2, Hsp70-binding protein 1, HSPBP1, Heat shock protein-binding protein 1, HspBP1
Reference ARO-P13047
Note For research use only.
Molecular Constructor
Asn133–Ser351
Product name ARO-P13047-50
Uniprot ID Q9NZL4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSS
Molecular weight 51.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn133-Ser351
Aliases /Synonyms Hsp70-binding protein 2, Hsp70-interacting protein 1, Hsp70-interacting protein 2, HSPBP, HspBP2, Hsp70-binding protein 1, HSPBP1, Heat shock protein-binding protein 1, HspBP1
Reference ARO-P13047
Note For research use only.
Molecular Constructor
Asn133–Ser351

Recombinant Human HSPBP1, N-GST

There are no reviews yet.

Be the first to review “Recombinant Human HSPBP1, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products