Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ID3 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q02535
Molecular weight:
21.69 kDa

Original price was: $257.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Lys2–Glu86
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ID3 Protein, N-His-SUMO

Product name ARO-P11965-100
Uniprot ID Q02535
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAE
Molecular weight 21.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys2-Glu86
Aliases /Synonyms ID3, 1R21, BHLHB25, bHLHb25, Class B basic helix-loop-helix protein 25, Inhibitor of differentiation 3, DNA-binding protein inhibitor ID-3, Inhibitor of DNA binding 3, HEIR1, Helix-loop-helix protein HEIR-1, ID-like protein inhibitor HLH 1R21
Reference ARO-P11965
Note For research use only.
Molecular Constructor
Lys2–Glu86
Product name ARO-P11965-1MG
Uniprot ID Q02535
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAE
Molecular weight 21.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys2-Glu86
Aliases /Synonyms ID3, 1R21, BHLHB25, bHLHb25, Class B basic helix-loop-helix protein 25, Inhibitor of differentiation 3, DNA-binding protein inhibitor ID-3, Inhibitor of DNA binding 3, HEIR1, Helix-loop-helix protein HEIR-1, ID-like protein inhibitor HLH 1R21
Reference ARO-P11965
Note For research use only.
Molecular Constructor
Lys2–Glu86
Product name ARO-P11965-50
Uniprot ID Q02535
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAE
Molecular weight 21.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys2-Glu86
Aliases /Synonyms ID3, 1R21, BHLHB25, bHLHb25, Class B basic helix-loop-helix protein 25, Inhibitor of differentiation 3, DNA-binding protein inhibitor ID-3, Inhibitor of DNA binding 3, HEIR1, Helix-loop-helix protein HEIR-1, ID-like protein inhibitor HLH 1R21
Reference ARO-P11965
Note For research use only.
Molecular Constructor
Lys2–Glu86

Introduction to Recombinant Human ID3 Protein

Recombinant human ID3 protein, also known as inhibitor of DNA binding 3, is a protein that plays a crucial role in the regulation of cell differentiation and proliferation. It is a member of the ID family of proteins, which are known for their ability to inhibit the function of basic helix-loop-helix (bHLH) transcription factors. Recombinant human ID3 protein is produced through genetic engineering techniques, making it a valuable tool for scientific research and various applications in the field of biotechnology.

Structure of Recombinant Human ID3 Protein

The recombinant human ID3 protein is composed of 115 amino acids and has a molecular weight of approximately 13 kDa. It contains a highly conserved helix-loop-helix (HLH) domain, which is responsible for its inhibitory function. This domain allows the protein to interact with bHLH transcription factors and prevent them from binding to DNA and regulating gene expression. Recombinant human ID3 protein also contains a nuclear localization signal (NLS), which allows it to enter the nucleus and exert its inhibitory effects on gene transcription.

Activity of Recombinant Human ID3 Protein

The main function of recombinant human ID3 protein is to regulate cell differentiation and proliferation by inhibiting the activity of bHLH transcription factors. These transcription factors play important roles in the development and function of various cell types, including muscle, blood, and nerve cells. By binding to bHLH transcription factors, recombinant human ID3 protein prevents them from binding to DNA and activating gene expression, thus regulating cell differentiation and proliferation.

In addition to its role in cell differentiation and proliferation, recombinant human ID3 protein has also been shown to play a role in other cellular processes such as apoptosis and cell cycle regulation. It has been found to interact with various signaling pathways and proteins involved in these processes, further highlighting its importance in cellular function.

Applications of Recombinant Human ID3 Protein

Recombinant human ID3 protein has a wide range of applications in the field of biotechnology and scientific research. Its ability to inhibit bHLH transcription factors makes it a valuable tool for studying the role of these transcription factors in various cellular processes. It can also be used to investigate the effects of recombinant human ID3 protein on cell differentiation and proliferation, as well as its interactions with other signaling pathways and proteins.

Moreover, recombinant human ID3 protein has potential therapeutic applications. Its ability to regulate cell differentiation and proliferation makes it a potential target for the treatment of diseases such as cancer, where these processes are dysregulated. It can also be used as a potential treatment for muscle and nerve disorders, as well as blood-related disorders.

In conclusion, recombinant human ID3 protein is a crucial protein in the regulation of cell differentiation and proliferation. Its unique structure and inhibitory activity make it a valuable tool for scientific research and various applications in biotechnology. Further studies on this protein may lead to a better understanding of its role in cellular processes and potential therapeutic applications.

Recombinant Human ID3 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human ID3 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products