Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human IL11 Protein, N-His-SUMO

  • ARO-P11311-50
  • Validated ELISA
Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P20809
Molecular weight:
30.34 kDa

Original price was: $309.00.Current price is: $274.00.

50ug 11% OFF + 274 loyalty points
Asp34–Leu199
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human IL11 Protein, N-His-SUMO in ELISA Assay
Recombinant Human IL11 Protein, N-His-SUMO

Recombinant Human IL11 Protein, N-His-SUMO

Product name ARO-P11311-100
Uniprot ID P20809
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Molecular weight 30.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp34-Leu199
Aliases /Synonyms Adipogenesis inhibitory factor, AGIF, IL11, IL-11, Interleukin-11, Oprelvekin
Reference ARO-P11311
Note For research use only.
Molecular Constructor
Asp34–Leu199
Product name ARO-P11311-1MG
Uniprot ID P20809
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Molecular weight 30.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp34-Leu199
Aliases /Synonyms Adipogenesis inhibitory factor, AGIF, IL11, IL-11, Interleukin-11, Oprelvekin
Reference ARO-P11311
Note For research use only.
Molecular Constructor
Asp34–Leu199
Product name ARO-P11311-50
Uniprot ID P20809
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Molecular weight 30.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp34-Leu199
Aliases /Synonyms Adipogenesis inhibitory factor, AGIF, IL11, IL-11, Interleukin-11, Oprelvekin
Reference ARO-P11311
Note For research use only.
Molecular Constructor
Asp34–Leu199

Recombinant Human IL11 Protein, N-His-SUMO in ELISA Assay

Recombinant Human IL11 Protein, N-His-SUMO in ELISA Assay

Recombinant Human IL11 Protein, N-His-SUMO can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Recombinant Human IL11 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human IL11 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products