Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MED30 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96HR3
Molecular weight:
21.34 kDa

Original price was: $257.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Asn29–Gly105
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MED30 Protein, N-His-SUMO

Product name ARO-P11952-100
Uniprot ID Q96HR3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGG
Molecular weight 21.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn29-Gly105
Aliases /Synonyms MED30, THRAP6, Mediator complex subunit 30, Thyroid hormone receptor-associated protein 6, TRAP25, TRAP/Mediator complex component TRAP25, Trap25, Mediator of RNA polymerase II transcription subunit 30, Thyroid hormone receptor-associated protein complex 25 kDa component
Reference ARO-P11952
Note For research use only.
Molecular Constructor
Asn29–Gly105
Product name ARO-P11952-1MG
Uniprot ID Q96HR3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGG
Molecular weight 21.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn29-Gly105
Aliases /Synonyms MED30, THRAP6, Mediator complex subunit 30, Thyroid hormone receptor-associated protein 6, TRAP25, TRAP/Mediator complex component TRAP25, Trap25, Mediator of RNA polymerase II transcription subunit 30, Thyroid hormone receptor-associated protein complex 25 kDa component
Reference ARO-P11952
Note For research use only.
Molecular Constructor
Asn29–Gly105
Product name ARO-P11952-50
Uniprot ID Q96HR3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGG
Molecular weight 21.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn29-Gly105
Aliases /Synonyms MED30, THRAP6, Mediator complex subunit 30, Thyroid hormone receptor-associated protein 6, TRAP25, TRAP/Mediator complex component TRAP25, Trap25, Mediator of RNA polymerase II transcription subunit 30, Thyroid hormone receptor-associated protein complex 25 kDa component
Reference ARO-P11952
Note For research use only.
Molecular Constructor
Asn29–Gly105

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques. These proteins have become essential tools in various fields of research, diagnostics, and therapeutics. One such protein is Recombinant Human MED30 Protein, which has gained significant attention in recent years due to its unique structure, activity, and application. In this article, we will explore the various aspects of this protein in detail.

Structure of Recombinant Human MED30 Protein

Recombinant Human MED30 Protein is a 30-kDa protein that belongs to the Mediator complex. This complex plays a crucial role in transcriptional regulation by mediating the interaction between transcription factors and RNA polymerase II. The MED30 protein is a subunit of the Mediator complex and is essential for its stability and function.

The MED30 protein consists of 261 amino acids and has a conserved structure among different species, including humans, mice, and rats. It has a globular domain at the N-terminus and a long unstructured tail at the C-terminus. The globular domain contains a hydrophobic pocket that is responsible for its interaction with other subunits of the Mediator complex.

Activity of Recombinant Human MED30 Protein

The MED30 protein plays a crucial role in the regulation of gene expression. It acts as a bridge between transcription factors and RNA polymerase II, facilitating the formation of the pre-initiation complex. This complex is essential for the initiation of transcription and subsequent gene expression.

Apart from its role in transcriptional regulation, the MED30 protein has also been linked to other cellular processes, such as DNA repair and cell cycle progression. Studies have shown that depletion of MED30 protein leads to defects in DNA repair and cell cycle arrest, highlighting its importance in maintaining genomic stability.

Application of Recombinant Human MED30 Protein

The unique structure and activity of Recombinant Human MED30 Protein make it a valuable tool in various fields of research. One of its primary applications is in the study of transcriptional regulation. Researchers use recombinant MED30 protein to understand its role in the Mediator complex and its interaction with other subunits.

Recombinant Human MED30 Protein has also been used in the development of diagnostic assays for various diseases. Studies have shown that the expression of MED30 protein is dysregulated in certain cancers, making it a potential biomarker for early detection and monitoring of these diseases.

Furthermore, the MED30 protein has also been studied as a potential target for therapeutic interventions. Its involvement in DNA repair and cell cycle regulation makes it a promising target for cancer treatment. Researchers are exploring the use of recombinant MED30 protein as a therapeutic agent to inhibit cancer cell growth and promote cell death.

Conclusion

In conclusion, Recombinant Human MED30 Protein is a 30-kDa protein that plays a crucial role in transcriptional regulation. Its unique structure, activity, and application make it a valuable tool in various fields of research, diagnostics, and therapeutics. Further studies on this protein will provide a better understanding of its role in cellular processes and its potential as a therapeutic target.

Recombinant Human MED30 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human MED30 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products