Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MGLL, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99685
Molecular weight:
35.57 kDa

Original price was: $296.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Met1–Pro303
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MGLL, N-His

Product name ARO-P13152-100
Uniprot ID Q99685
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP
Molecular weight 35.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro303
Aliases /Synonyms Lysophospholipase-like, MGLL, Monoacylglycerol lipase, Lysophospholipase homolog, MGL, Monoglyceride lipase, HU-K5, MAGL
Reference ARO-P13152
Note For research use only.
Molecular Constructor
Met1–Pro303
Product name ARO-P13152-1MG
Uniprot ID Q99685
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP
Molecular weight 35.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro303
Aliases /Synonyms Lysophospholipase-like, MGLL, Monoacylglycerol lipase, Lysophospholipase homolog, MGL, Monoglyceride lipase, HU-K5, MAGL
Reference ARO-P13152
Note For research use only.
Molecular Constructor
Met1–Pro303
Product name ARO-P13152-50
Uniprot ID Q99685
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP
Molecular weight 35.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro303
Aliases /Synonyms Lysophospholipase-like, MGLL, Monoacylglycerol lipase, Lysophospholipase homolog, MGL, Monoglyceride lipase, HU-K5, MAGL
Reference ARO-P13152
Note For research use only.
Molecular Constructor
Met1–Pro303

Introduction

Recombinant Human MGLL (monoglyceride lipase) is a protein that plays a crucial role in lipid metabolism. It is a member of the serine hydrolase family and is responsible for the hydrolysis of monoglycerides into fatty acids and glycerol. This protein is highly conserved among different species, indicating its importance in biological processes. In this article, we will discuss the structure, activity, and applications of Recombinant Human MGLL.

Structure of Recombinant Human MGLL

Recombinant Human MGLL is a 38 kDa protein that consists of 370 amino acids. It is composed of an N-terminal domain, a catalytic domain, and a C-terminal domain. The N-terminal domain contains a signal peptide that is responsible for the secretion of the protein. The catalytic domain contains a serine hydrolase motif, which is essential for the enzymatic activity of MGLL. The C-terminal domain is responsible for the binding of MGLL to the cell membrane, where it carries out its function.

Activity of Recombinant Human MGLL

MGLL is primarily expressed in the brain and is present in high levels in the hippocampus, hypothalamus, and cerebellum. It is also found in other tissues such as the liver, heart, and skeletal muscles. MGLL is a lipase enzyme that catalyzes the hydrolysis of monoglycerides into fatty acids and glycerol. It is involved in the metabolism of dietary fats and the production of endocannabinoids, which are important signaling molecules in the brain. MGLL is also involved in the regulation of energy homeostasis and has been linked to obesity and metabolic disorders.

Application of Recombinant Human MGLL

Recombinant Human MGLL has various applications in the field of research and medicine. One of its primary uses is in the production of recombinant proteins. MGLL is a highly expressed protein in the brain, and its recombinant form can be used to study its structure and function. It can also be used to produce monoclonal antibodies against MGLL, which can be used for diagnostic and therapeutic purposes. Recombinant Human MGLL can also be used to study the role of this protein in lipid metabolism and its link to obesity and metabolic disorders.

Another important application of Recombinant Human MGLL is in drug discovery. MGLL inhibitors have been developed as potential therapeutics for the treatment of obesity, diabetes, and other metabolic disorders. Recombinant Human MGLL can be used to screen and identify novel inhibitors that can potentially be developed into drugs. It can also be used to study the mechanism of action of these inhibitors and their effects on lipid metabolism.

Moreover, Recombinant Human MGLL has been used in vaccine development as an antigen. MGLL is highly expressed in the brain, and its recombinant form can be used to induce an immune response against this protein. This can be useful in developing vaccines against neurological disorders such as Alzheimer’s disease, where MGLL has been found to play a role.

Conclusion

Recombinant Human MGLL is a crucial protein involved in lipid metabolism and the regulation of energy homeostasis. Its structure and activity make it an important target for research and drug development. Its recombinant form has various applications in the production of proteins, drug discovery, and vaccine development. Further studies on Recombinant Human MGLL can provide valuable insights into its role in various biological processes and its potential as a therapeutic target.

Recombinant Human MGLL, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MGLL, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products