Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MRPS18B Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y676
Molecular weight:
15.95 kDa

Original price was: $257.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Lys52–His166
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MRPS18B Protein, N-His

Product name ARO-P12601-100
Uniprot ID Q9Y676
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYH
Molecular weight 15.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys52-His166
Aliases /Synonyms C6orf14, MRP-S18-2, Mitochondrial small ribosomal subunit protein bS18b, Mitochondrial small ribosomal subunit protein mS40, MRPS18B, MRP-S18-b, 28S ribosomal protein S18b, mitochondrial, S18mt-b, 28S ribosomal protein S18-2, mitochondrial, Mrps18-b
Reference ARO-P12601
Note For research use only.
Molecular Constructor
Lys52–His166
Product name ARO-P12601-1MG
Uniprot ID Q9Y676
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYH
Molecular weight 15.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys52-His166
Aliases /Synonyms C6orf14, MRP-S18-2, Mitochondrial small ribosomal subunit protein bS18b, Mitochondrial small ribosomal subunit protein mS40, MRPS18B, MRP-S18-b, 28S ribosomal protein S18b, mitochondrial, S18mt-b, 28S ribosomal protein S18-2, mitochondrial, Mrps18-b
Reference ARO-P12601
Note For research use only.
Molecular Constructor
Lys52–His166
Product name ARO-P12601-50
Uniprot ID Q9Y676
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYH
Molecular weight 15.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys52-His166
Aliases /Synonyms C6orf14, MRP-S18-2, Mitochondrial small ribosomal subunit protein bS18b, Mitochondrial small ribosomal subunit protein mS40, MRPS18B, MRP-S18-b, 28S ribosomal protein S18b, mitochondrial, S18mt-b, 28S ribosomal protein S18-2, mitochondrial, Mrps18-b
Reference ARO-P12601
Note For research use only.
Molecular Constructor
Lys52–His166

Introduction

Recombinant Human MRPS18B Protein, also known as mitochondrial ribosomal protein S18B, is a protein that is encoded by the MRPS18B gene. This protein is a component of the small subunit of the mitochondrial ribosome and plays a crucial role in protein synthesis within the mitochondria. In this article, we will discuss the structure, activity, and application of Recombinant Human MRPS18B Protein.

Structure of Recombinant Human MRPS18B Protein

Recombinant Human MRPS18B Protein is a 16 kDa protein that consists of 142 amino acids. It has a conserved S18 domain, which is a characteristic feature of ribosomal proteins. This domain is responsible for binding to the small subunit of the mitochondrial ribosome. The protein also contains a highly conserved N-terminal domain, which is essential for its function in protein synthesis.

Activity of Recombinant Human MRPS18B Protein

Recombinant Human MRPS18B Protein is a key component of the small subunit of the mitochondrial ribosome, which is responsible for translating messenger RNA (mRNA) into proteins. It plays a crucial role in the initiation of protein synthesis by binding to the 12S rRNA, which is a component of the small subunit of the mitochondrial ribosome. This binding is essential for the proper assembly and function of the ribosome.

Moreover, Recombinant Human MRPS18B Protein is also involved in the maintenance of mitochondrial DNA (mtDNA). It has been shown to interact with mtDNA and play a role in the replication and repair of mtDNA. This protein is also involved in the regulation of mitochondrial gene expression, which is crucial for the proper functioning of the mitochondria.

Applications of Recombinant Human MRPS18B Protein

Recombinant Human MRPS18B Protein has a wide range of applications in the field of molecular biology and biotechnology. One of its main applications is in research studies to understand the structure and function of the mitochondrial ribosome. This protein can be used to study the role of ribosomal proteins in protein synthesis and their interactions with other components of the ribosome.

Moreover, Recombinant Human MRPS18B Protein has been used in the development of diagnostic tools for mitochondrial disorders. Mutations in the MRPS18B gene have been linked to various mitochondrial diseases, and the use of recombinant protein can aid in the diagnosis of these disorders. Additionally, this protein has potential therapeutic applications in the treatment of mitochondrial diseases.

Furthermore, Recombinant Human MRPS18B Protein can also be used as an antigen in the production of antibodies. Antibodies against this protein can be used in various research and diagnostic applications, such as western blotting, immunohistochemistry, and enzyme-linked immunosorbent assay (ELISA).

Conclusion

In conclusion, Recombinant Human MRPS18B Protein is a crucial component of the small subunit of the mitochondrial ribosome. It plays a vital role in protein synthesis and the maintenance of mtDNA. This protein has a wide range of applications in research, diagnosis, and potential therapeutic interventions. Further studies on this protein can provide valuable insights into the functioning of the mitochondria and its role in various diseases.

Recombinant Human MRPS18B Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MRPS18B Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products