Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MRPS25 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P82663
Molecular weight:
24.79 kDa

Original price was: $393.00.Current price is: $327.00.

100ug 17% OFF + 327 loyalty points
Pro2–Gly107
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MRPS25 Protein, N-His-SUMO

Product name ARO-P12141-100
Uniprot ID P82663
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILG
Molecular weight 24.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Gly107
Aliases /Synonyms MRP-S25, 28S ribosomal protein S25, mitochondrial, S25mt, RPMS25, Mitochondrial small ribosomal subunit protein mS25, MRPS25
Reference ARO-P12141
Note For research use only.
Molecular Constructor
Pro2–Gly107
Product name ARO-P12141-1MG
Uniprot ID P82663
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILG
Molecular weight 24.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Gly107
Aliases /Synonyms MRP-S25, 28S ribosomal protein S25, mitochondrial, S25mt, RPMS25, Mitochondrial small ribosomal subunit protein mS25, MRPS25
Reference ARO-P12141
Note For research use only.
Molecular Constructor
Pro2–Gly107
Product name ARO-P12141-50
Uniprot ID P82663
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILG
Molecular weight 24.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Gly107
Aliases /Synonyms MRP-S25, 28S ribosomal protein S25, mitochondrial, S25mt, RPMS25, Mitochondrial small ribosomal subunit protein mS25, MRPS25
Reference ARO-P12141
Note For research use only.
Molecular Constructor
Pro2–Gly107

Introduction to Recombinant Human MRPS25 Protein

Recombinant Human MRPS25 Protein, also known as Mitochondrial Ribosomal Protein S25, is a protein that is encoded by the MRPS25 gene in humans. It is a component of the small subunit of the mitochondrial ribosome and plays a crucial role in protein synthesis within the mitochondria. In this article, we will delve deeper into the structure, activity, and applications of this important recombinant protein.

Structure of Recombinant Human MRPS25 Protein

The MRPS25 gene is located on chromosome 1 and is composed of 6 exons that span over 11 kilobases. The protein itself is composed of 103 amino acids with a molecular weight of 11.8 kDa. It is a highly conserved protein, with identical or similar sequences found in various species such as mice, rats, and zebrafish.

The crystal structure of Recombinant Human MRPS25 Protein has been determined, revealing its unique 3-dimensional shape. It consists of two domains, the N-terminal domain and the C-terminal domain, connected by a flexible linker region. The N-terminal domain is responsible for binding to the small subunit of the mitochondrial ribosome, while the C-terminal domain is involved in the recruitment of aminoacyl-tRNA during protein synthesis.

Activity of Recombinant Human MRPS25 Protein

Recombinant Human MRPS25 Protein is a crucial component of the small subunit of the mitochondrial ribosome, which is responsible for translating the genetic code into proteins within the mitochondria. It specifically binds to the 12S rRNA, a component of the small subunit, and helps in its proper folding and stabilization.

Furthermore, Recombinant Human MRPS25 Protein is involved in the recruitment of aminoacyl-tRNA during protein synthesis. It interacts with the mitochondrial translation elongation factor EF-Tu, which is responsible for delivering the correct aminoacyl-tRNA to the ribosome. This interaction is essential for the proper functioning of the mitochondrial ribosome and efficient protein synthesis.

Applications of Recombinant Human MRPS25 Protein

Recombinant Human MRPS25 Protein has several applications in both research and clinical settings. It is commonly used as an antigen in studies aimed at understanding the role of mitochondrial ribosomal proteins in various diseases. For example, mutations in MRPS25 have been linked to mitochondrial encephalomyopathy, lactic acidosis, and stroke-like episodes (MELAS) syndrome, a rare genetic disorder affecting the brain and muscles.

Additionally, Recombinant Human MRPS25 Protein has been used in studies investigating the role of mitochondrial ribosomal proteins in cancer. It has been found to be overexpressed in certain types of cancer, such as hepatocellular carcinoma, and may play a role in tumor growth and progression. It is also being studied as a potential therapeutic target for cancer treatment.

In clinical settings, Recombinant Human MRPS25 Protein can be used as a diagnostic tool for MELAS syndrome. Detection of mutations in the MRPS25 gene can aid in the diagnosis of this rare disorder, which can be difficult to diagnose based on symptoms alone.

Conclusion

In summary, Recombinant Human MRPS25 Protein is an essential component of the small subunit of the mitochondrial ribosome, involved in protein synthesis within the mitochondria. Its unique structure and activity make it an important protein in various research and clinical applications. Further studies on this protein may provide valuable insights into the role of mitochondrial ribosomal proteins in various diseases and their potential as therapeutic targets.

Recombinant Human MRPS25 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human MRPS25 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products