Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MYLK2, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H1R3
Molecular weight:
31.28 kDa

Original price was: $326.00.Current price is: $274.00.

50ug 16% OFF + 274 loyalty points
Ala313–Lys562
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MYLK2, N-His

Product name ARO-P13113-100
Uniprot ID Q9H1R3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AKVIKKQTPKDKEMVLLEIEVMNQLNHRNLIQLYAAIETPHEIVLFMEYIEGGELFERIVDEDYHLTEVDTMVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGHLVKIIDFGLARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKTDMWSMGVITYMLLSGLSPFLGDDDTETLNNVLSGNWYFDEETFEAVSDEAKDFVSNLIVKDQRARMNAAQCLAHPWLNNLAEKAKRCNRRLKSQILLKK
Molecular weight 31.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala313-Lys562
Aliases /Synonyms Myosin light chain kinase 2, skeletal/cardiac muscle, MLCK2, MYLK2
Reference ARO-P13113
Note For research use only.
Molecular Constructor
Ala313–Lys562
Product name ARO-P13113-1MG
Uniprot ID Q9H1R3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AKVIKKQTPKDKEMVLLEIEVMNQLNHRNLIQLYAAIETPHEIVLFMEYIEGGELFERIVDEDYHLTEVDTMVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGHLVKIIDFGLARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKTDMWSMGVITYMLLSGLSPFLGDDDTETLNNVLSGNWYFDEETFEAVSDEAKDFVSNLIVKDQRARMNAAQCLAHPWLNNLAEKAKRCNRRLKSQILLKK
Molecular weight 31.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala313-Lys562
Aliases /Synonyms Myosin light chain kinase 2, skeletal/cardiac muscle, MLCK2, MYLK2
Reference ARO-P13113
Note For research use only.
Molecular Constructor
Ala313–Lys562
Product name ARO-P13113-50
Uniprot ID Q9H1R3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AKVIKKQTPKDKEMVLLEIEVMNQLNHRNLIQLYAAIETPHEIVLFMEYIEGGELFERIVDEDYHLTEVDTMVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGHLVKIIDFGLARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKTDMWSMGVITYMLLSGLSPFLGDDDTETLNNVLSGNWYFDEETFEAVSDEAKDFVSNLIVKDQRARMNAAQCLAHPWLNNLAEKAKRCNRRLKSQILLKK
Molecular weight 31.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala313-Lys562
Aliases /Synonyms Myosin light chain kinase 2, skeletal/cardiac muscle, MLCK2, MYLK2
Reference ARO-P13113
Note For research use only.
Molecular Constructor
Ala313–Lys562

Introduction

Recombinant Human MYLK2, also known as Myosin Light Chain Kinase 2, is a protein that plays a crucial role in the regulation of smooth muscle contraction. It is a member of the myosin light chain kinase family and is encoded by the MYLK2 gene. Recombinant Human MYLK2 is produced through genetic engineering techniques, making it a highly pure and specific protein with a wide range of applications in the field of biomedical research.

Structure of Recombinant Human MYLK2

Recombinant Human MYLK2 is a 59 kDa protein composed of 528 amino acids. It contains a kinase domain at the N-terminus, followed by a calmodulin-binding domain and a coiled-coil region. The C-terminus of the protein contains a leucine zipper motif, which is involved in protein-protein interactions. This unique structure allows Recombinant Human MYLK2 to interact with various signaling molecules and regulate smooth muscle contraction.

Activity of Recombinant Human MYLK2

The primary function of Recombinant Human MYLK2 is to phosphorylate the regulatory light chain of myosin (MLC20), which is essential for smooth muscle contraction. This process is triggered by the binding of calcium ions to the calmodulin-binding domain of MYLK2, which activates its kinase activity. The phosphorylation of MLC20 leads to the activation of myosin, which then binds to actin filaments and generates the force needed for muscle contraction.

In addition to its role in smooth muscle contraction, Recombinant Human MYLK2 has also been implicated in other cellular processes, such as cell migration, cell division, and cell adhesion. It has been shown to interact with various proteins involved in these processes, suggesting a broader role for MYLK2 in cellular functions.

Application of Recombinant Human MYLK2

Recombinant Human MYLK2 has a wide range of applications in biomedical research, particularly in the study of smooth muscle physiology and diseases. Here are some of the specific applications of Recombinant Human MYLK2:

1. Study of smooth muscle contraction

Recombinant Human MYLK2 is a crucial tool for studying the mechanisms of smooth muscle contraction. Its ability to specifically phosphorylate MLC20 allows researchers to investigate the role of MYLK2 in this process and its interactions with other signaling molecules.

2. Drug discovery and development

Abnormalities in MYLK2 activity have been linked to various diseases, such as hypertension, asthma, and atherosclerosis. Recombinant Human MYLK2 can be used to screen potential drugs that target MYLK2 and its associated pathways, leading to the development of new treatments for these diseases.

3. Biomarker for cancer diagnosis

Recent studies have shown that MYLK2 is overexpressed in certain types of cancer, including breast and colon cancer. Recombinant Human MYLK2 can be used as a biomarker to detect the presence of these cancers and monitor their progression.

4. Production of monoclonal antibodies

Recombinant Human MYLK2 can be used as an antigen to produce monoclonal antibodies specific to MYLK2. These antibodies can then be used for various applications, such as protein detection and purification, as well as in diagnostics and therapeutics.

5. Gene therapy

Mutations in the MYLK2 gene have been associated with various diseases, including hypertrophic cardiomyopathy and coronary artery disease. Recombinant Human MYLK2 can be used in gene therapy to replace the defective gene and restore normal MYLK2 function.

Conclusion

In summary, Recombinant Human MYLK2 is a highly specific and versatile protein with a crucial role in smooth muscle physiology. Its unique structure and activity make it an essential tool in various fields of biomedical research, including drug discovery, cancer diagnosis, and

Recombinant Human MYLK2, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MYLK2, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products