Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NHEJ1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H9Q4
Molecular weight:
16.53 kDa

Original price was: $262.00.Current price is: $230.00.

50ug 12% OFF + 230 loyalty points
Met1–Ser127
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NHEJ1 Protein, N-His

Product name ARO-P12118-100
Uniprot ID Q9H9Q4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLAS
Molecular weight 16.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser127
Aliases /Synonyms Non-homologous end-joining factor 1, XRCC4-like factor, NHEJ1, XLF, Protein cernunnos
Reference ARO-P12118
Note For research use only.
Molecular Constructor
Met1–Ser127
Product name ARO-P12118-1MG
Uniprot ID Q9H9Q4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLAS
Molecular weight 16.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser127
Aliases /Synonyms Non-homologous end-joining factor 1, XRCC4-like factor, NHEJ1, XLF, Protein cernunnos
Reference ARO-P12118
Note For research use only.
Molecular Constructor
Met1–Ser127
Product name ARO-P12118-50
Uniprot ID Q9H9Q4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLAS
Molecular weight 16.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser127
Aliases /Synonyms Non-homologous end-joining factor 1, XRCC4-like factor, NHEJ1, XLF, Protein cernunnos
Reference ARO-P12118
Note For research use only.
Molecular Constructor
Met1–Ser127

Introduction

The NHEJ1 protein, also known as DNA-PKcs, is a key component of the non-homologous end joining (NHEJ) pathway, which is responsible for repairing DNA double-strand breaks (DSBs). Recombinant human NHEJ1 protein, produced through genetic engineering techniques, has become an essential tool in the study of DNA repair mechanisms and has potential applications in cancer therapy and gene therapy. In this article, we will explore the structure, activity, and applications of recombinant human NHEJ1 protein.

Structure of Recombinant Human NHEJ1 Protein

The NHEJ1 protein is a large polypeptide chain consisting of 4128 amino acids with a molecular weight of approximately 469 kDa. It is composed of multiple domains, including the N-terminal domain, the kinase domain, the helical domain, and the C-terminal domain. The N-terminal domain is responsible for binding to DNA and other proteins, while the kinase domain is essential for the catalytic activity of the protein. The helical domain plays a crucial role in the interaction between NHEJ1 and other proteins involved in the NHEJ pathway, and the C-terminal domain is involved in the regulation of the protein’s activity.

Recombinant human NHEJ1 protein is produced by expressing the NHEJ1 gene in a suitable host cell, such as E. coli or mammalian cells. The protein is then purified using various techniques, such as chromatography and gel filtration, to obtain a highly pure and active form of the protein.

Activity of Recombinant Human NHEJ1 Protein

The main function of NHEJ1 protein is to repair DNA DSBs, which can be caused by various factors, such as radiation, chemicals, and errors during DNA replication. The NHEJ pathway is the primary mechanism for repairing these breaks in mammalian cells, and NHEJ1 is a crucial component of this pathway.

Upon binding to a DSB, NHEJ1 recruits other proteins, including Ku70/80 and DNA ligase IV, to form a complex that repairs the break. The kinase domain of NHEJ1 plays a crucial role in this process by phosphorylating other proteins, which helps in the recruitment and activation of other repair enzymes. Additionally, the helical domain of NHEJ1 is involved in the proper alignment of the broken DNA ends, ensuring accurate repair.

Recombinant human NHEJ1 protein has been extensively studied in vitro, and its activity has been shown to be similar to that of the native protein. It has also been successfully used in reconstitution experiments to study the NHEJ pathway and its components.

Applications of Recombinant Human NHEJ1 Protein

Recombinant human NHEJ1 protein has various applications in both research and medicine. Its role in DNA repair makes it a valuable tool for studying the mechanisms of DNA damage and repair. It has been used in various in vitro and in vivo experiments to understand the role of NHEJ1 in different cellular processes, such as cell cycle regulation and genomic stability.

Moreover, NHEJ1 protein has potential applications in cancer therapy. Cancer cells often have defects in the NHEJ pathway, making them more dependent on other DNA repair mechanisms. Inhibiting NHEJ1 activity in these cells can lead to the accumulation of DNA damage, resulting in cell death. Recombinant NHEJ1 protein can be used to study this potential therapeutic approach and develop targeted cancer treatments.

Another potential application of recombinant NHEJ1 protein is in gene therapy. The NHEJ pathway is essential for the repair of DNA DSBs caused by gene editing techniques such as CRISPR-Cas9. The use of recombinant NHEJ1 protein can enhance the efficiency of gene editing by promoting accurate repair of these breaks

Recombinant Human NHEJ1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NHEJ1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products