Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GABARAPL1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H0R8
Molecular weight:
16.21 kDa

Original price was: $376.00.Current price is: $327.00.

100ug 13% OFF + 327 loyalty points
Met1–Lys117
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GABARAPL1 Protein, N-His

Product name ARO-P12606-100
Uniprot ID Q9H0R8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
Molecular weight 16.21 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys117
Aliases /Synonyms Early estrogen-regulated protein, Gamma-aminobutyric acid receptor-associated protein-like 1, GEC-1, GABARAPL1, Glandular epithelial cell protein 1, GEC1, GABA(A) receptor-associated protein-like 1
Reference ARO-P12606
Note For research use only.
Molecular Constructor
Met1–Lys117
Product name ARO-P12606-1MG
Uniprot ID Q9H0R8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
Molecular weight 16.21 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys117
Aliases /Synonyms Early estrogen-regulated protein, Gamma-aminobutyric acid receptor-associated protein-like 1, GEC-1, GABARAPL1, Glandular epithelial cell protein 1, GEC1, GABA(A) receptor-associated protein-like 1
Reference ARO-P12606
Note For research use only.
Molecular Constructor
Met1–Lys117
Product name ARO-P12606-50
Uniprot ID Q9H0R8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
Molecular weight 16.21 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys117
Aliases /Synonyms Early estrogen-regulated protein, Gamma-aminobutyric acid receptor-associated protein-like 1, GEC-1, GABARAPL1, Glandular epithelial cell protein 1, GEC1, GABA(A) receptor-associated protein-like 1
Reference ARO-P12606
Note For research use only.
Molecular Constructor
Met1–Lys117

Introduction

Recombinant Human GABARAPL1 Protein, also known as Gamma-aminobutyric acid receptor-associated protein-like 1, is a protein that plays a crucial role in the regulation of autophagy, a process that is responsible for the degradation and recycling of cellular components. This protein is a member of the GABARAP family, which includes GABARAP, GABARAPL1, and GABARAPL2, and is highly conserved among species. In this article, we will discuss the structure, activity, and application of Recombinant Human GABARAPL1 Protein.

Structure of Recombinant Human GABARAPL1 Protein

Recombinant Human GABARAPL1 Protein is a 117 amino acid protein with a molecular weight of approximately 13 kDa. It contains a conserved C-terminal Gly residue that is essential for the conjugation of lipid molecules during the process of autophagy. The protein also has a conserved N-terminal domain that is responsible for binding to other proteins and organelles involved in autophagy. The crystal structure of Recombinant Human GABARAPL1 Protein has been determined, and it shows a compact globular structure with a central hydrophobic core.

Activity of Recombinant Human GABARAPL1 Protein

Recombinant Human GABARAPL1 Protein is a key player in the process of autophagy, which is essential for maintaining cellular homeostasis and the removal of damaged or unnecessary cellular components. This protein is involved in the formation of autophagosomes, the double-membrane structures that engulf cellular cargo targeted for degradation. It does so by binding to the autophagosome membrane and recruiting other proteins and organelles involved in the process. Recombinant Human GABARAPL1 Protein also plays a role in the fusion of autophagosomes with lysosomes, where the cellular cargo is degraded.

Application of Recombinant Human GABARAPL1 Protein

Recombinant Human GABARAPL1 Protein has various applications in both research and therapeutic settings. One of the main applications of this protein is in studying the process of autophagy. By using recombinant GABARAPL1 protein, researchers can better understand the role of this protein in autophagy and its interaction with other proteins and organelles involved in the process. This can lead to a better understanding of autophagy-related diseases and the development of potential treatments.

Another application of Recombinant Human GABARAPL1 Protein is in drug discovery. Autophagy has been linked to various diseases, including cancer, neurodegenerative disorders, and infectious diseases. By targeting the autophagy pathway and specifically Recombinant Human GABARAPL1 Protein, researchers can develop potential drugs to treat these diseases. In fact, some studies have shown that inhibiting GABARAPL1 can lead to decreased tumor growth in certain types of cancer, making it a potential target for cancer therapy.

Recombinant Human GABARAPL1 Protein also has potential therapeutic applications. As mentioned earlier, this protein is involved in the process of autophagy, which is essential for maintaining cellular homeostasis. Dysregulation of autophagy has been linked to various diseases, and targeting GABARAPL1 could potentially restore the balance and improve disease outcomes. Additionally, recombinant GABARAPL1 protein can be used as a therapeutic agent to deliver drugs or other therapeutic molecules directly to the autophagosome, allowing for more targeted and efficient treatment.

Conclusion

In conclusion, Recombinant Human GABARAPL1 Protein is a key player in the process of autophagy and has various applications in research and therapeutics. Its structure, activity, and role in autophagy make it a promising target for drug discovery and potential therapeutic interventions. Further research on this protein and

Recombinant Human GABARAPL1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GABARAPL1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products