Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human PMEL Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P40967
Molecular weight:
27.62 kDa

Original price was: $339.00.Current price is: $274.00.

50ug 19% OFF + 274 loyalty points
Gln65–Thr299
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human PMEL Protein, N-His

Recombinant Human PMEL Protein, N-His

Product name ARO-P12458-100
Uniprot ID P40967
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GGQVSLKVSNDGPTLIGANASFSIALNFPGSQKVLPDGQVIWVNNTIINGSQVWGGQPVYPQETDDACIFPDGGPCPSGSWSQKRSFVYVWKTWGQYWQVLGGPVSGLSIGTGRAMLGTHTMEVTVYHRRGSRSYVPLAHSSSAFTITDQVPFSVSVSQLRALDGGNKHFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTYLEPGPVTAQVVLQAAIPL
Molecular weight 27.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln65-Thr299
Aliases /Synonyms ME20M, Melanocyte protein PMEL, Silver locus protein homolog, Secreted melanoma-associated ME20 antigen, D12S53E, 95 kDa melanocyte-specific secreted glycoprotein, SILV, P100, Premelanosome protein, PMEL17, ME20S, PMEL, ME20-S, ME20-M, P26, P1, Melanocytes lineage-specific antigen GP100, Melanocyte protein Pmel 17, Melanoma-associated ME20 antigen
Reference ARO-P12458
Note For research use only.
Molecular Constructor
Gln65–Thr299
Product name ARO-P12458-1MG
Uniprot ID P40967
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GGQVSLKVSNDGPTLIGANASFSIALNFPGSQKVLPDGQVIWVNNTIINGSQVWGGQPVYPQETDDACIFPDGGPCPSGSWSQKRSFVYVWKTWGQYWQVLGGPVSGLSIGTGRAMLGTHTMEVTVYHRRGSRSYVPLAHSSSAFTITDQVPFSVSVSQLRALDGGNKHFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTYLEPGPVTAQVVLQAAIPL
Molecular weight 27.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln65-Thr299
Aliases /Synonyms ME20M, Melanocyte protein PMEL, Silver locus protein homolog, Secreted melanoma-associated ME20 antigen, D12S53E, 95 kDa melanocyte-specific secreted glycoprotein, SILV, P100, Premelanosome protein, PMEL17, ME20S, PMEL, ME20-S, ME20-M, P26, P1, Melanocytes lineage-specific antigen GP100, Melanocyte protein Pmel 17, Melanoma-associated ME20 antigen
Reference ARO-P12458
Note For research use only.
Molecular Constructor
Gln65–Thr299
Product name ARO-P12458-50
Uniprot ID P40967
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GGQVSLKVSNDGPTLIGANASFSIALNFPGSQKVLPDGQVIWVNNTIINGSQVWGGQPVYPQETDDACIFPDGGPCPSGSWSQKRSFVYVWKTWGQYWQVLGGPVSGLSIGTGRAMLGTHTMEVTVYHRRGSRSYVPLAHSSSAFTITDQVPFSVSVSQLRALDGGNKHFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTYLEPGPVTAQVVLQAAIPL
Molecular weight 27.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln65-Thr299
Aliases /Synonyms ME20M, Melanocyte protein PMEL, Silver locus protein homolog, Secreted melanoma-associated ME20 antigen, D12S53E, 95 kDa melanocyte-specific secreted glycoprotein, SILV, P100, Premelanosome protein, PMEL17, ME20S, PMEL, ME20-S, ME20-M, P26, P1, Melanocytes lineage-specific antigen GP100, Melanocyte protein Pmel 17, Melanoma-associated ME20 antigen
Reference ARO-P12458
Note For research use only.
Molecular Constructor
Gln65–Thr299

Recombinant Human PMEL Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PMEL Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products