Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SUMF1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8NBK3
Molecular weight:
30.00 kDa

Original price was: $264.00.Current price is: $230.00.

50ug 13% OFF + 230 loyalty points
Glu113–Ser356
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SUMF1, N-His

Product name ARO-P13242-100
Uniprot ID Q8NBK3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDS
Molecular weight 30.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu113-Ser356
Aliases /Synonyms Formylglycine-generating enzyme, FGE, SUMF1, Sulfatase-modifying factor 1, C-alpha-formylglycine-generating enzyme 1
Reference ARO-P13242
Note For research use only.
Molecular Constructor
Glu113–Ser356
Product name ARO-P13242-1MG
Uniprot ID Q8NBK3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDS
Molecular weight 30.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu113-Ser356
Aliases /Synonyms Formylglycine-generating enzyme, FGE, SUMF1, Sulfatase-modifying factor 1, C-alpha-formylglycine-generating enzyme 1
Reference ARO-P13242
Note For research use only.
Molecular Constructor
Glu113–Ser356
Product name ARO-P13242-50
Uniprot ID Q8NBK3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDS
Molecular weight 30.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu113-Ser356
Aliases /Synonyms Formylglycine-generating enzyme, FGE, SUMF1, Sulfatase-modifying factor 1, C-alpha-formylglycine-generating enzyme 1
Reference ARO-P13242
Note For research use only.
Molecular Constructor
Glu113–Ser356

Introduction

Recombinant Human SUMF1 is a type of recombinant protein that plays a crucial role in various biological processes. This protein is a member of the sulfatase family, which are enzymes that catalyze the hydrolysis of sulfate esters. The recombinant form of SUMF1 is produced through genetic engineering techniques, making it a valuable tool for scientific research and potential therapeutic applications. In this article, we will explore the structure, activity, and potential applications of Recombinant Human SUMF1.

Structure of Recombinant Human SUMF1

The gene encoding SUMF1 is located on chromosome 3 in humans and contains 8 exons. The protein itself is composed of 247 amino acids and has a molecular weight of approximately 28 kDa. It is a homodimer, meaning it is composed of two identical subunits. Each subunit has a unique structure consisting of two domains: a catalytic domain and a C-terminal domain.

The catalytic domain is responsible for the enzyme activity of SUMF1. It contains a conserved active site, which is essential for the hydrolysis of sulfate esters. The C-terminal domain, on the other hand, is involved in protein-protein interactions and is crucial for the stability and proper folding of the protein.

Activity of Recombinant Human SUMF1

The main function of SUMF1 is to catalyze the hydrolysis of sulfated sugars, specifically 3-O-sulfogalactosylceramide (sulfatide). This reaction is important for the breakdown of sulfatide, which is a component of the myelin sheath in the nervous system. Deficiencies in SUMF1 activity have been linked to lysosomal storage disorders, such as multiple sulfatase deficiency and metachromatic leukodystrophy.

In addition to its role in sulfatide metabolism, SUMF1 has also been found to be involved in the processing of heparan sulfate, a complex polysaccharide that plays a critical role in cell signaling and communication. This suggests that SUMF1 may have a broader role in the regulation of various biological processes.

Applications of Recombinant Human SUMF1

The production of recombinant Human SUMF1 has opened up new opportunities for scientific research and potential therapeutic applications. One of the main uses of this protein is in the development of diagnostic assays for lysosomal storage disorders. By measuring the activity of recombinant SUMF1, researchers can accurately diagnose these disorders and monitor their progression.

Recombinant Human SUMF1 also has potential therapeutic applications. As mentioned earlier, deficiencies in SUMF1 activity have been linked to lysosomal storage disorders. Therefore, the use of recombinant SUMF1 as a therapeutic agent could potentially correct these deficiencies and improve the symptoms of these disorders.

In addition, SUMF1 has also been found to have anti-inflammatory properties. Studies have shown that recombinant SUMF1 can inhibit the production of pro-inflammatory cytokines, making it a potential treatment for inflammatory diseases such as rheumatoid arthritis and inflammatory bowel disease.

Conclusion

Recombinant Human SUMF1 is a valuable tool for scientific research and has potential therapeutic applications. Its unique structure and enzyme activity make it a crucial component in the breakdown of sulfated sugars and the regulation of various biological processes. With ongoing research, we can continue to uncover the full potential of this protein and its role in human health and disease.

Recombinant Human SUMF1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SUMF1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products