Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human S100A16, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96FQ6
Molecular weight:
13.98 kDa

Original price was: $276.00.Current price is: $230.00.

50ug 17% OFF + 230 loyalty points
Ser2–Ser103
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human S100A16, N-His

Product name ARO-P13179-100
Uniprot ID Q96FQ6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
Molecular weight 13.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Ser103
Aliases /Synonyms S100A16, Aging-associated gene 13 protein, Protein S100-A16, S100 calcium-binding protein A16, S100F, Protein S100-F
Reference ARO-P13179
Note For research use only.
Molecular Constructor
Ser2–Ser103
Product name ARO-P13179-1MG
Uniprot ID Q96FQ6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
Molecular weight 13.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Ser103
Aliases /Synonyms S100A16, Aging-associated gene 13 protein, Protein S100-A16, S100 calcium-binding protein A16, S100F, Protein S100-F
Reference ARO-P13179
Note For research use only.
Molecular Constructor
Ser2–Ser103
Product name ARO-P13179-50
Uniprot ID Q96FQ6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
Molecular weight 13.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Ser103
Aliases /Synonyms S100A16, Aging-associated gene 13 protein, Protein S100-A16, S100 calcium-binding protein A16, S100F, Protein S100-F
Reference ARO-P13179
Note For research use only.
Molecular Constructor
Ser2–Ser103

Title: Introduction to Recombinant Human S100A16

Recombinant Human S100A16 is a protein that plays an important role in various cellular processes. It belongs to the S100 family of calcium-binding proteins and is highly conserved among different species. This protein is known for its diverse functions, including regulation of cell growth, differentiation, and motility. In this article, we will discuss the structure, activity, and potential applications of Recombinant Human S100A16.

Title: Structure of Recombinant Human S100A16

The human S100A16 gene is located on chromosome 1q21 and consists of three exons. The mature protein is composed of 89 amino acids with a molecular weight of approximately 10 kDa. It has a typical EF-hand motif, which is a conserved calcium-binding domain found in all S100 proteins. Recombinant Human S100A16 also contains a unique N-terminal extension, which is absent in other S100 proteins. This extension is thought to be responsible for its specific functions.

Title: Activity of Recombinant Human S100A16

Recombinant Human S100A16 is a calcium-binding protein, and its activity is regulated by the binding of calcium ions. It has been shown to interact with various cellular targets, including other proteins, nucleic acids, and lipids. This interaction is crucial for the regulation of cellular processes, such as cell growth and differentiation. Recombinant Human S100A16 has also been found to play a role in the regulation of intracellular calcium levels, which is essential for maintaining cellular homeostasis.

Title: Role of Recombinant Human S100A16 in Cancer

There is growing evidence that Recombinant Human S100A16 is involved in cancer development and progression. It has been found to be overexpressed in various types of cancer, including breast, lung, and colon cancer. Studies have shown that Recombinant Human S100A16 promotes cell proliferation and migration, which are key processes involved in cancer progression. It has also been linked to the development of drug resistance in cancer cells, making it a potential target for cancer therapy.

Title: Potential Applications of Recombinant Human S100A16

Due to its diverse functions, Recombinant Human S100A16 has potential applications in various fields. One of its main applications is in cancer research, where it can serve as a diagnostic marker and a potential target for therapy. It can also be used in drug discovery and development, as it has been found to interact with various proteins involved in cellular processes. Recombinant Human S100A16 can also be used in biotechnology, specifically in the production of recombinant proteins, as it has been shown to enhance protein expression in cells.

Title: Production of Recombinant Human S100A16

Recombinant Human S100A16 can be produced using various expression systems, such as bacterial, yeast, and mammalian cells. The protein can be purified using different techniques, including affinity chromatography and size exclusion chromatography. The yield and purity of the protein can be optimized by using different expression and purification strategies.

Title: Conclusion

In conclusion, Recombinant Human S100A16 is a calcium-binding protein with diverse functions in various cellular processes. Its structure, activity, and potential applications make it a promising target for further research and development. In particular, its role in cancer development and progression makes it a potential diagnostic marker and therapeutic target. With advancements in protein production and purification techniques, the production of Recombinant Human S100A16 for research and biotechnological applications is becoming more feasible. Further studies on this protein can provide valuable insights into its functions and potential applications in the future.

Recombinant Human S100A16, N-His

There are no reviews yet.

Be the first to review “Recombinant Human S100A16, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products