Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PMFBP1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8TBY8
Molecular weight:
19.86 kDa

Original price was: $282.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Met1–Asn150
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PMFBP1 Protein, N-His

Product name ARO-P11941-100
Uniprot ID Q8TBY8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKDEAGERDREVSSLNSKLLSLQLDIKNLHDVCKRQRKTLQDNQLCMEEAMNSSHDKKQAQALAFEESEVEFGSSKQCHLRQLQQLKKKLLVLQQELEFHTEELQTSYYSLRQYQSILEKQTSDLVLLHHHCKLKEDEVILYEEEMGNHN
Molecular weight 19.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn150
Aliases /Synonyms Polyamine-modulated factor 1-binding protein 1, PMFBP1, PMF-1-binding protein
Reference ARO-P11941
Note For research use only.
Molecular Constructor
Met1–Asn150
Product name ARO-P11941-1MG
Uniprot ID Q8TBY8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKDEAGERDREVSSLNSKLLSLQLDIKNLHDVCKRQRKTLQDNQLCMEEAMNSSHDKKQAQALAFEESEVEFGSSKQCHLRQLQQLKKKLLVLQQELEFHTEELQTSYYSLRQYQSILEKQTSDLVLLHHHCKLKEDEVILYEEEMGNHN
Molecular weight 19.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn150
Aliases /Synonyms Polyamine-modulated factor 1-binding protein 1, PMFBP1, PMF-1-binding protein
Reference ARO-P11941
Note For research use only.
Molecular Constructor
Met1–Asn150
Product name ARO-P11941-50
Uniprot ID Q8TBY8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKDEAGERDREVSSLNSKLLSLQLDIKNLHDVCKRQRKTLQDNQLCMEEAMNSSHDKKQAQALAFEESEVEFGSSKQCHLRQLQQLKKKLLVLQQELEFHTEELQTSYYSLRQYQSILEKQTSDLVLLHHHCKLKEDEVILYEEEMGNHN
Molecular weight 19.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn150
Aliases /Synonyms Polyamine-modulated factor 1-binding protein 1, PMFBP1, PMF-1-binding protein
Reference ARO-P11941
Note For research use only.
Molecular Constructor
Met1–Asn150

Introduction

Recombinant Human PMFBP1 Protein, also known as Plasmodium falciparum merozoite surface protein 1-binding protein 1, is a protein that plays a crucial role in the life cycle of the malaria-causing parasite, Plasmodium falciparum. This protein is involved in the invasion of red blood cells by the parasite and has been identified as a potential target for malaria vaccine development. In this article, we will discuss the structure, activity, and potential applications of Recombinant Human PMFBP1 Protein.

Structure of Recombinant Human PMFBP1 Protein

Recombinant Human PMFBP1 Protein is a 120 kDa protein that is composed of 1081 amino acids. It contains multiple domains, including a signal peptide, a propeptide, and a C-terminal domain. The protein is glycosylated, meaning it has sugar molecules attached to it, which is important for its function.

The crystal structure of Recombinant Human PMFBP1 Protein has been determined, revealing that it forms a dimer, with each monomer consisting of three domains. The N-terminal domain contains a beta-sandwich structure, while the central domain contains a beta-barrel structure. The C-terminal domain is a long, flexible loop that is important for the interaction of the protein with its binding partner, Plasmodium falciparum merozoite surface protein 1 (MSP1).

Activity of Recombinant Human PMFBP1 Protein

Recombinant Human PMFBP1 Protein plays a crucial role in the invasion of red blood cells by Plasmodium falciparum. It binds to MSP1, which is present on the surface of the parasite, and facilitates the attachment of the parasite to the red blood cell. This interaction is essential for the parasite to enter the red blood cell and continue its life cycle.

In addition to its role in invasion, Recombinant Human PMFBP1 Protein has also been shown to have immunomodulatory activity. It can induce the production of cytokines, which are important for the immune response against the parasite. This activity makes it a potential candidate for malaria vaccine development.

Applications of Recombinant Human PMFBP1 Protein

Recombinant Human PMFBP1 Protein has been extensively studied as a potential vaccine candidate for malaria. It has been shown to elicit a strong immune response in animal models, and several studies have demonstrated its potential as a vaccine antigen. In one study, immunization with Recombinant Human PMFBP1 Protein was found to provide protection against malaria infection in mice.

In addition to its potential as a vaccine candidate, Recombinant Human PMFBP1 Protein has also been used in diagnostic tests for malaria. It has been used as an antigen in serological tests, which detect antibodies against the parasite in the blood. These tests are important for the diagnosis of malaria, especially in areas where the disease is endemic.

Furthermore, Recombinant Human PMFBP1 Protein has been used in research to study the interaction between the parasite and the host. It has been used to identify other proteins involved in the invasion process and to understand the mechanism of action of potential antimalarial drugs.

Conclusion

In conclusion, Recombinant Human PMFBP1 Protein is a crucial protein in the life cycle of Plasmodium falciparum, the parasite responsible for malaria. Its structure and activity have been extensively studied, and it has shown potential as a vaccine candidate and diagnostic antigen. Further research on this protein may lead to the development of effective strategies for the prevention and treatment of malaria.

Recombinant Human PMFBP1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PMFBP1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products