Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PPP1CA, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P62136
Molecular weight:
39.69 kDa

Original price was: $337.00.Current price is: $274.00.

50ug 19% OFF + 274 loyalty points
His Ser2–Lys330
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PPP1CA, N-His

Product name ARO-P13584-100
Uniprot ID P62136
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
Molecular weight 39.69 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Lys330
Aliases /Synonyms Serine/threonine-protein phosphatase PP1-alpha catalytic subunit, PP-1A, PPP1A, PPP1CA
Reference ARO-P13584
Note For research use only.
Molecular Constructor
His Ser2–Lys330
Product name ARO-P13584-1MG
Uniprot ID P62136
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
Molecular weight 39.69 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Lys330
Aliases /Synonyms Serine/threonine-protein phosphatase PP1-alpha catalytic subunit, PP-1A, PPP1A, PPP1CA
Reference ARO-P13584
Note For research use only.
Molecular Constructor
His Ser2–Lys330
Product name ARO-P13584-50
Uniprot ID P62136
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
Molecular weight 39.69 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Lys330
Aliases /Synonyms Serine/threonine-protein phosphatase PP1-alpha catalytic subunit, PP-1A, PPP1A, PPP1CA
Reference ARO-P13584
Note For research use only.
Molecular Constructor
His Ser2–Lys330

Introduction to Recombinant Human PPP1CA

Recombinant Human PPP1CA is a protein that is produced through the process of genetic engineering, also known as recombinant DNA technology. This protein is a member of the protein phosphatase 1 (PP1) family and plays a crucial role in various cellular processes, including cell division, metabolism, and gene expression.

Structure of Recombinant Human PPP1CA

The recombinant Human PPP1CA protein is composed of 330 amino acids and has a molecular weight of approximately 37 kDa. It has a conserved catalytic domain, which is responsible for its enzymatic activity, and two regulatory subunits, known as the C-terminus and the N-terminus.

The catalytic domain of Recombinant Human PPP1CA has a characteristic structure known as the “catalytic triad,” which consists of three amino acids (aspartate, histidine, and serine) that are essential for its phosphatase activity. This domain is highly conserved among all members of the PP1 family and is crucial for the dephosphorylation of target proteins.

The regulatory subunits, on the other hand, play a role in determining the substrate specificity and subcellular localization of Recombinant Human PPP1CA. They also help in the regulation of its activity by binding to specific proteins or molecules.

Activity of Recombinant Human PPP1CA

Recombinant Human PPP1CA is a serine/threonine phosphatase that catalyzes the removal of phosphate groups from target proteins. This dephosphorylation process is essential for the regulation of various cellular processes, including cell cycle progression, signal transduction, and metabolism.

The main function of Recombinant Human PPP1CA is to counterbalance the activity of protein kinases, which add phosphate groups to proteins and regulate their function. By removing these phosphate groups, Recombinant Human PPP1CA helps maintain the balance of phosphorylation in the cell and ensures proper cellular functioning.

Furthermore, Recombinant Human PPP1CA has been shown to play a role in the regulation of gene expression. It has been found to dephosphorylate proteins involved in the control of transcription, such as RNA polymerase II, and thus, influences the expression of various genes.

Applications of Recombinant Human PPP1CA

Recombinant Human PPP1CA has numerous applications in both research and therapeutic settings. Its ability to dephosphorylate target proteins makes it a valuable tool for studying the role of phosphorylation in various cellular processes. It is also used in the production of recombinant proteins, as it can remove phosphate groups that may interfere with the proper folding and function of the protein of interest.

In the field of drug discovery, Recombinant Human PPP1CA has been identified as a potential drug target for the treatment of various diseases. Abnormal regulation of protein phosphorylation has been linked to the development of cancer, neurodegenerative disorders, and metabolic diseases. By targeting Recombinant Human PPP1CA, researchers hope to develop new therapies that can modulate the activity of this protein and restore the balance of phosphorylation in diseased cells.

In conclusion, Recombinant Human PPP1CA is a crucial protein that plays a vital role in regulating various cellular processes. Its structure, activity, and applications make it a valuable tool in scientific research and a potential target for the development of new therapies. As our understanding of this protein continues to grow, we can expect to see even more significant contributions to the fields of cell biology and medicine.

Recombinant Human PPP1CA, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PPP1CA, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products