Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PRKG2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13237
Molecular weight:
40.58 kDa

Original price was: $339.00.Current price is: $274.00.

50ug 19% OFF + 274 loyalty points
Ser431–Phe762
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PRKG2 Protein, N-His

Product name ARO-P12003-100
Uniprot ID Q13237
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF
Molecular weight 40.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser431-Phe762
Aliases /Synonyms cGK2, cGK 2, PRKG2, cGKII, PRKGR2, cGMP-dependent protein kinase II, cGMP-dependent protein kinase 2
Reference ARO-P12003
Note For research use only.
Molecular Constructor
Ser431–Phe762
Product name ARO-P12003-1MG
Uniprot ID Q13237
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF
Molecular weight 40.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser431-Phe762
Aliases /Synonyms cGK2, cGK 2, PRKG2, cGKII, PRKGR2, cGMP-dependent protein kinase II, cGMP-dependent protein kinase 2
Reference ARO-P12003
Note For research use only.
Molecular Constructor
Ser431–Phe762
Product name ARO-P12003-50
Uniprot ID Q13237
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF
Molecular weight 40.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser431-Phe762
Aliases /Synonyms cGK2, cGK 2, PRKG2, cGKII, PRKGR2, cGMP-dependent protein kinase II, cGMP-dependent protein kinase 2
Reference ARO-P12003
Note For research use only.
Molecular Constructor
Ser431–Phe762

Introduction

Recombinant Human PRKG2 Protein, also known as cGMP-dependent protein kinase 2, is a crucial enzyme involved in various cellular signaling pathways. This protein is encoded by the PRKG2 gene and is a member of the protein kinase family. It plays a vital role in regulating smooth muscle contraction, platelet activation, and neuronal signaling. In this article, we will discuss the structure, activity, and applications of Recombinant Human PRKG2 Protein.

Structure of Recombinant Human PRKG2 Protein

Recombinant Human PRKG2 Protein is a 75 kDa protein consisting of 671 amino acids. It has a catalytic domain and a regulatory domain. The catalytic domain contains a highly conserved kinase core, while the regulatory domain has two cGMP-binding sites. The protein also has an autoinhibitory domain that prevents its activity in the absence of cGMP.

Activity of Recombinant Human PRKG2 Protein

Recombinant Human PRKG2 Protein is a serine/threonine kinase that is activated by the binding of cGMP. Upon activation, it phosphorylates various target proteins, leading to changes in their activity and function. One of the major targets of this protein is myosin light chain, which is involved in smooth muscle contraction. By phosphorylating myosin light chain, Recombinant Human PRKG2 Protein inhibits smooth muscle contraction, resulting in vasodilation and decreased blood pressure.

In platelets, this protein plays a crucial role in regulating their activation and aggregation. It phosphorylates several proteins involved in platelet activation, leading to decreased platelet aggregation and reduced risk of blood clots. This makes Recombinant Human PRKG2 Protein a potential therapeutic target for cardiovascular diseases.

In neuronal cells, this protein is involved in the regulation of synaptic plasticity, which is crucial for learning and memory. It also plays a role in neuronal survival and differentiation. Dysregulation of this protein has been linked to various neurological disorders, making it a potential target for drug development.

Applications of Recombinant Human PRKG2 Protein

The recombinant form of this protein has numerous applications in the field of biotechnology and medicine. It is widely used in research studies to understand the role of cGMP signaling in various cellular processes. Recombinant Human PRKG2 Protein is also used to develop diagnostic assays for certain diseases, such as cardiovascular disorders and neurological disorders.

Due to its role in smooth muscle relaxation, Recombinant Human PRKG2 Protein has potential therapeutic applications in the treatment of hypertension and other cardiovascular diseases. It can also be used to develop drugs for the prevention of blood clots and stroke. In addition, this protein has shown promising results in preclinical studies for the treatment of neurological disorders, such as Alzheimer’s disease and Parkinson’s disease.

Conclusion

In conclusion, Recombinant Human PRKG2 Protein is a crucial enzyme involved in various cellular signaling pathways. Its structure, activity, and applications make it a valuable tool for research and potential target for drug development. Further studies on this protein may lead to the development of novel therapies for various diseases.

Recombinant Human PRKG2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PRKG2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products