Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PROX1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q92786
Molecular weight:
24.51 kDa

Original price was: $280.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Thr546–His736
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PROX1, N-His

Product name ARO-P13205-100
Uniprot ID Q92786
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLH
Molecular weight 24.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr546-His736
Aliases /Synonyms PROX1, Prospero homeobox protein 1, PROX-1, Homeobox prospero-like protein PROX1
Reference ARO-P13205
Note For research use only.
Molecular Constructor
Thr546–His736
Product name ARO-P13205-1MG
Uniprot ID Q92786
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLH
Molecular weight 24.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr546-His736
Aliases /Synonyms PROX1, Prospero homeobox protein 1, PROX-1, Homeobox prospero-like protein PROX1
Reference ARO-P13205
Note For research use only.
Molecular Constructor
Thr546–His736
Product name ARO-P13205-50
Uniprot ID Q92786
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLH
Molecular weight 24.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr546-His736
Aliases /Synonyms PROX1, Prospero homeobox protein 1, PROX-1, Homeobox prospero-like protein PROX1
Reference ARO-P13205
Note For research use only.
Molecular Constructor
Thr546–His736

Introduction

Recombinant Human PROX1 is a protein that plays a crucial role in the development and maintenance of various tissues and organs in the human body. It is a transcription factor that regulates the expression of genes involved in cell differentiation, proliferation, and survival. This protein has garnered significant interest in the scientific community due to its potential applications in various fields, including cancer research, tissue engineering, and regenerative medicine.

Structure of Recombinant Human PROX1

Recombinant Human PROX1 is a 75 kDa protein that is composed of 737 amino acids. It belongs to the prospero homeobox family of transcription factors and contains a highly conserved DNA-binding homeodomain. This domain is responsible for the protein’s ability to bind to specific DNA sequences and regulate gene expression. Additionally, PROX1 has two proline-rich regions that are important for protein-protein interactions, allowing it to interact with other proteins and form complexes.

Activity of Recombinant Human PROX1

The main function of PROX1 is to regulate gene expression by binding to specific DNA sequences and either activating or repressing the transcription of target genes. It has been shown to play a crucial role in the development of several tissues and organs, including the liver, lymphatic system, and central nervous system. In the liver, PROX1 is involved in the differentiation of hepatocytes and bile duct cells, while in the lymphatic system, it is essential for the formation and maintenance of lymphatic vessels. In the central nervous system, PROX1 is responsible for the development and survival of neurons.

In addition to its role in development, PROX1 has also been implicated in various diseases. Research has shown that alterations in PROX1 expression or function can contribute to the development of cancer, particularly in the liver, breast, and prostate. This protein has also been linked to diabetic retinopathy, where it plays a role in the formation of new blood vessels in the retina.

Applications of Recombinant Human PROX1

Recombinant Human PROX1 has numerous potential applications in various fields of research and medicine. One of its most promising applications is in cancer research, where it can serve as a potential therapeutic target. By understanding the role of PROX1 in cancer development, researchers can develop targeted therapies that can inhibit its activity and potentially stop the growth and spread of cancer cells.

Another potential application of PROX1 is in tissue engineering and regenerative medicine. As PROX1 is involved in the development and maintenance of various tissues and organs, it can potentially be used to promote tissue regeneration and repair damaged tissues. For example, in the liver, PROX1 could be used to stimulate the differentiation of hepatocytes from stem cells, allowing for the regeneration of liver tissue in patients with liver disease.

Furthermore, PROX1 can also be used as a diagnostic marker for various diseases. As its expression is altered in cancer and other diseases, measuring PROX1 levels in patient samples could potentially aid in early detection and diagnosis of these conditions.

Conclusion

In summary, Recombinant Human PROX1 is a crucial protein with diverse functions in development, disease, and potential applications in various fields. Its structure and activity make it a promising target for cancer therapy and a potential tool for tissue engineering and regenerative medicine. Further research on this protein is needed to fully understand its role in human health and disease, and to explore its potential in various applications.

Recombinant Human PROX1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PROX1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products