Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SLC22A5 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O76082
Molecular weight:
23.51 kDa

Original price was: $301.00.Current price is: $274.00.

50ug 9% OFF + 274 loyalty points
Thr45–Lys141
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SLC22A5 Protein, N-His-SUMO

Product name ARO-P12048-100
Uniprot ID O76082
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TPEHRCRVPDAANLSSAWRNHTVPLRLRDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTIVTEWNLVCEDDWK
Molecular weight 23.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr45-Lys141
Aliases /Synonyms SLC22A5, Organic cation/carnitine transporter 2, High-affinity sodium-dependent carnitine cotransporter, OCTN2, Solute carrier family 22 member 5
Reference ARO-P12048
Note For research use only.
Molecular Constructor
Thr45–Lys141
Product name ARO-P12048-1MG
Uniprot ID O76082
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TPEHRCRVPDAANLSSAWRNHTVPLRLRDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTIVTEWNLVCEDDWK
Molecular weight 23.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr45-Lys141
Aliases /Synonyms SLC22A5, Organic cation/carnitine transporter 2, High-affinity sodium-dependent carnitine cotransporter, OCTN2, Solute carrier family 22 member 5
Reference ARO-P12048
Note For research use only.
Molecular Constructor
Thr45–Lys141
Product name ARO-P12048-50
Uniprot ID O76082
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TPEHRCRVPDAANLSSAWRNHTVPLRLRDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTIVTEWNLVCEDDWK
Molecular weight 23.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr45-Lys141
Aliases /Synonyms SLC22A5, Organic cation/carnitine transporter 2, High-affinity sodium-dependent carnitine cotransporter, OCTN2, Solute carrier family 22 member 5
Reference ARO-P12048
Note For research use only.
Molecular Constructor
Thr45–Lys141

Title: Introduction to Recombinant Human SLC22A5 Protein

Recombinant human SLC22A5 protein, also known as the organic cation transporter 2 (OCT2), is a membrane protein that plays a crucial role in the transport of organic cations across cell membranes. This protein is encoded by the SLC22A5 gene and is primarily expressed in the kidney, liver, and brain. Recombinant human SLC22A5 protein is widely used in research and clinical applications due to its structural and functional properties.

Structure of Recombinant Human SLC22A5 Protein

The recombinant human SLC22A5 protein is composed of 12 transmembrane domains, with both the N- and C-termini located on the cytoplasmic side of the membrane. The protein has a molecular weight of approximately 60 kDa and contains several conserved domains, including the OCTN2 domain, which is responsible for the transport of cationic compounds. The structure of the recombinant protein is highly homologous to the native human protein, making it an ideal tool for studying its function and interactions.

Activity of Recombinant Human SLC22A5 Protein

The main function of recombinant human SLC22A5 protein is to transport organic cations across cell membranes. This includes a wide range of molecules, such as neurotransmitters, drugs, and toxins. The protein uses a proton gradient to transport these cations against their concentration gradient, which is essential for maintaining homeostasis in the body. In addition to its transport function, recombinant human SLC22A5 protein has been shown to play a role in the regulation of cellular metabolism and the detoxification of xenobiotics.

Application of Recombinant Human SLC22A5 Protein

Recombinant human SLC22A5 protein has a wide range of applications in both research and clinical settings. In research, the protein is used to study the function and regulation of organic cation transporters. It is also used to investigate the role of these transporters in drug absorption, distribution, and excretion. In addition, recombinant human SLC22A5 protein is used to screen potential drug candidates for their interaction with this transporter, which can impact their efficacy and toxicity.

In the clinical setting, recombinant human SLC22A5 protein is used as an antigen in diagnostic assays for the detection of anti-OCT2 antibodies in patients with autoimmune diseases, such as Sjögren’s syndrome and systemic lupus erythematosus. These antibodies can interfere with the function of the protein and lead to impaired transport and drug interactions. By detecting these antibodies, clinicians can better manage drug therapies and improve patient outcomes.

Conclusion

In summary, recombinant human SLC22A5 protein is a crucial tool in the study of organic cation transporters and their role in drug transport and metabolism. Its structural and functional properties make it an ideal protein for research and diagnostic applications. As our understanding of the role of this protein continues to grow, so does the potential for new therapeutic strategies and diagnostic tools.

Recombinant Human SLC22A5 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human SLC22A5 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products