Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SLC30A6 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q6NXT4
Molecular weight:
23.51 kDa

Original price was: $264.00.Current price is: $230.00.

50ug 13% OFF + 230 loyalty points
Ser247–Asp334
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SLC30A6 Protein, N-His-SUMO & C-Strep

Product name ARO-P11862-100
Uniprot ID Q6NXT4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKD
Molecular weight 23.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser247-Asp334
Aliases /Synonyms ZnT-6, Solute carrier family 30 member 6, Zinc transporter 6, ZNT6, SLC30A6
Reference ARO-P11862
Note For research use only.
Molecular Constructor
Ser247–Asp334
Product name ARO-P11862-1MG
Uniprot ID Q6NXT4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKD
Molecular weight 23.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser247-Asp334
Aliases /Synonyms ZnT-6, Solute carrier family 30 member 6, Zinc transporter 6, ZNT6, SLC30A6
Reference ARO-P11862
Note For research use only.
Molecular Constructor
Ser247–Asp334
Product name ARO-P11862-50
Uniprot ID Q6NXT4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKD
Molecular weight 23.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser247-Asp334
Aliases /Synonyms ZnT-6, Solute carrier family 30 member 6, Zinc transporter 6, ZNT6, SLC30A6
Reference ARO-P11862
Note For research use only.
Molecular Constructor
Ser247–Asp334

Introduction to Recombinant Human SLC30A6 Protein

Recombinant human SLC30A6 protein, also known as zinc transporter 6 (ZnT-6), is a transmembrane protein that plays a crucial role in the transport of zinc ions across cellular membranes. This protein belongs to the SLC30 family, which comprises of 10 members, and is encoded by the SLC30A6 gene located on chromosome 4q22.1. Recombinant human SLC30A6 protein is produced through genetic engineering techniques, making it a highly purified and biologically active protein with a wide range of applications in the field of biotechnology and medicine.

Structure of Recombinant Human SLC30A6 Protein

The recombinant human SLC30A6 protein is composed of 400 amino acids and has a molecular weight of approximately 44 kDa. It consists of six transmembrane domains (TMDs) and a large cytoplasmic loop between TMDs IV and V. This protein also contains a histidine-rich domain in the cytoplasmic loop, which is responsible for the binding and transport of zinc ions. Recombinant human SLC30A6 protein has a conserved sequence motif, CXXC, which is essential for its zinc-binding and transport function.

Activity of Recombinant Human SLC30A6 Protein

Recombinant human SLC30A6 protein is a zinc transporter that plays a vital role in maintaining zinc homeostasis in cells. It is primarily expressed in various tissues, including the brain, liver, kidney, and pancreas. This protein is localized to the Golgi apparatus and endoplasmic reticulum, where it facilitates the transport of zinc from the cytoplasm into the lumen of these organelles. Recombinant human SLC30A6 protein is responsible for the efflux of zinc ions from the cytoplasm, thereby preventing zinc toxicity and maintaining the appropriate levels of zinc in the cell.

Moreover, recombinant human SLC30A6 protein also plays a crucial role in the regulation of insulin secretion by pancreatic beta cells. It has been shown that this protein is upregulated in response to high glucose levels, and it facilitates the transport of zinc into insulin-containing secretory granules. This zinc influx is essential for the maturation and storage of insulin, which is released upon glucose stimulation. Therefore, recombinant human SLC30A6 protein is crucial for maintaining glucose homeostasis in the body.

Applications of Recombinant Human SLC30A6 Protein

Recombinant human SLC30A6 protein has a wide range of applications in the field of biotechnology and medicine. One of the major applications of this protein is in the production of therapeutic insulin. The zinc transport activity of recombinant human SLC30A6 protein is essential for the maturation and storage of insulin, making it a crucial component in the production of high-quality insulin for the treatment of diabetes.

Furthermore, recombinant human SLC30A6 protein has also been studied as a potential therapeutic target for various diseases. It has been shown that mutations in the SLC30A6 gene can lead to zinc deficiency, which is associated with a range of disorders, including diabetes, Alzheimer’s disease, and cancer. Therefore, understanding the structure and function of recombinant human SLC30A6 protein can provide valuable insights into the development of novel treatments for these diseases.

In addition, recombinant human SLC30A6 protein has been used in various research studies to investigate the role of zinc in cellular processes. Its zinc transport activity has been linked to the regulation of immune response, cell growth, and apoptosis. By studying the function of this protein, researchers can gain a better understanding of the role of zinc in these processes and its implications in disease development.

Conclusion

Recombinant Human SLC30A6 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human SLC30A6 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products