Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TRPV6/ECaC2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H1D0
Molecular weight:
28.27 kDa

Original price was: $393.00.Current price is: $327.00.

100ug 17% OFF + 327 loyalty points
Ser87–Asp319
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TRPV6/ECaC2 Protein, N-His

Product name ARO-P11868-100
Uniprot ID Q9H1D0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPLLLAAKDNDVQALNKLLKYEDCKVHQRGAMGETALHIAALYDNLEAAMVLMEAAPELVFEPMTSELYEGQTALHIAVVNQNMNLVRALLARRASVSARATGTAFRRSPCNLIYFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDRHGDHLQPLDLVPNHQGLTPFKLAGVEGNTVMFQHLMQKRKHTQWTYGPLTSTLYD
Molecular weight 28.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser87-Asp319
Aliases /Synonyms CaT1, Transient receptor potential cation channel subfamily V member 6, CaT-like, TrpV6, CaT-L, ECAC2, TRPV6, ECaC2, Epithelial calcium channel 2, Calcium transport protein 1
Reference ARO-P11868
Note For research use only.
Molecular Constructor
Ser87–Asp319
Product name ARO-P11868-1MG
Uniprot ID Q9H1D0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPLLLAAKDNDVQALNKLLKYEDCKVHQRGAMGETALHIAALYDNLEAAMVLMEAAPELVFEPMTSELYEGQTALHIAVVNQNMNLVRALLARRASVSARATGTAFRRSPCNLIYFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDRHGDHLQPLDLVPNHQGLTPFKLAGVEGNTVMFQHLMQKRKHTQWTYGPLTSTLYD
Molecular weight 28.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser87-Asp319
Aliases /Synonyms CaT1, Transient receptor potential cation channel subfamily V member 6, CaT-like, TrpV6, CaT-L, ECAC2, TRPV6, ECaC2, Epithelial calcium channel 2, Calcium transport protein 1
Reference ARO-P11868
Note For research use only.
Molecular Constructor
Ser87–Asp319
Product name ARO-P11868-50
Uniprot ID Q9H1D0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPLLLAAKDNDVQALNKLLKYEDCKVHQRGAMGETALHIAALYDNLEAAMVLMEAAPELVFEPMTSELYEGQTALHIAVVNQNMNLVRALLARRASVSARATGTAFRRSPCNLIYFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDRHGDHLQPLDLVPNHQGLTPFKLAGVEGNTVMFQHLMQKRKHTQWTYGPLTSTLYD
Molecular weight 28.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser87-Asp319
Aliases /Synonyms CaT1, Transient receptor potential cation channel subfamily V member 6, CaT-like, TrpV6, CaT-L, ECAC2, TRPV6, ECaC2, Epithelial calcium channel 2, Calcium transport protein 1
Reference ARO-P11868
Note For research use only.
Molecular Constructor
Ser87–Asp319

Introduction

Recombinant Human TRPV6/ECaC2 protein is a type of recombinant protein that is widely used in scientific research and medical applications. This protein is a member of the transient receptor potential (TRP) family of ion channels, which play important roles in various physiological processes. In this article, we will provide a detailed description of the structure, activity, and applications of Recombinant Human TRPV6/ECaC2 protein.

Structure of Recombinant Human TRPV6/ECaC2 Protein

The TRPV6/ECaC2 protein is a transmembrane protein that is composed of 747 amino acids. It has a molecular weight of approximately 84 kDa and consists of six transmembrane domains, a pore-forming region, and intracellular N- and C-termini. The structure of this protein is highly conserved among different species, with 95% sequence identity between human and mouse TRPV6/ECaC2 proteins.

The transmembrane domains of TRPV6/ECaC2 protein are responsible for forming a channel through which ions can pass. The pore-forming region contains several amino acid residues that are crucial for the selectivity and permeability of the channel. The intracellular N- and C-termini are involved in the regulation of the channel’s activity.

Activity of Recombinant Human TRPV6/ECaC2 Protein

The main function of TRPV6/ECaC2 protein is to regulate the transport of calcium ions across cell membranes. This protein is highly selective for calcium ions and is able to transport them against a concentration gradient. It is primarily expressed in epithelial cells of the intestine, kidney, and placenta, where it plays a crucial role in maintaining calcium homeostasis.

The activity of TRPV6/ECaC2 protein is regulated by various factors, including hormones, pH, and other signaling molecules. Upon activation, this protein opens its channel, allowing calcium ions to flow into the cell. This influx of calcium ions is essential for various cellular processes, such as muscle contraction, nerve signaling, and bone formation.

Applications of Recombinant Human TRPV6/ECaC2 Protein

Recombinant Human TRPV6/ECaC2 protein has a wide range of applications in scientific research and medical fields. Some of the major applications of this protein are listed below:

1. Study of Calcium Homeostasis

As TRPV6/ECaC2 protein is an important regulator of calcium transport, it is widely used in studies related to calcium homeostasis. Researchers use recombinant TRPV6/ECaC2 protein to investigate the mechanisms involved in calcium absorption, transport, and regulation in different tissues and cells.

2. Development of Therapeutics

Dysfunction of TRPV6/ECaC2 protein has been linked to various diseases, such as calcium deficiency, kidney stones, and certain types of cancer. Therefore, recombinant TRPV6/ECaC2 protein is being studied as a potential target for the development of therapeutics to treat these conditions. In addition, this protein is also being used in drug discovery studies to identify novel compounds that can modulate its activity.

3. Production of Antibodies

Recombinant Human TRPV6/ECaC2 protein is also used as an antigen to produce specific antibodies. These antibodies can be used to detect the expression and localization of TRPV6/ECaC2 protein in different tissues and cells. They are also useful in functional studies of this protein, such as measuring its activity and binding properties.

4. Cell-Based Assays

Recombinant TRPV6/ECaC2 protein is used in cell-based assays to study its activity and regulation. These assays involve the use of cells that overexpress TRPV6/ECaC2 protein, which can be used

Recombinant Human TRPV6/ECaC2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TRPV6/ECaC2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products