Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SLCO2A1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q92959
Molecular weight:
22.72 kDa

Original price was: $294.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Met418–Ala518
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SLCO2A1 Protein, N-His-SUMO

Product name ARO-P11942-100
Uniprot ID Q92959
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGCSTPTVAEVYPPSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAHFLLPA
Molecular weight 22.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met418-Ala518
Aliases /Synonyms OATP2A1, Solute carrier family 21 member 2, Prostaglandin transporter, Solute carrier organic anion transporter family member 2A1, SLCO2A1, SLC21A2, PGT
Reference ARO-P11942
Note For research use only.
Molecular Constructor
Met418–Ala518
Product name ARO-P11942-1MG
Uniprot ID Q92959
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGCSTPTVAEVYPPSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAHFLLPA
Molecular weight 22.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met418-Ala518
Aliases /Synonyms OATP2A1, Solute carrier family 21 member 2, Prostaglandin transporter, Solute carrier organic anion transporter family member 2A1, SLCO2A1, SLC21A2, PGT
Reference ARO-P11942
Note For research use only.
Molecular Constructor
Met418–Ala518
Product name ARO-P11942-50
Uniprot ID Q92959
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGCSTPTVAEVYPPSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAHFLLPA
Molecular weight 22.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met418-Ala518
Aliases /Synonyms OATP2A1, Solute carrier family 21 member 2, Prostaglandin transporter, Solute carrier organic anion transporter family member 2A1, SLCO2A1, SLC21A2, PGT
Reference ARO-P11942
Note For research use only.
Molecular Constructor
Met418–Ala518

Introduction

The SLCO2A1 gene encodes for the protein OATP2A1, which is a member of the organic anion transporting polypeptide (OATP) family. This protein is responsible for the transport of various molecules, including hormones, drugs, and toxins, across cell membranes. Recombinant Human SLCO2A1 Protein is a synthetic version of this protein that is produced in a laboratory setting using genetic engineering techniques. In this article, we will discuss the structure, activity, and applications of this recombinant protein.

Structure of Recombinant Human SLCO2A1 Protein

The structure of Recombinant Human SLCO2A1 Protein is similar to that of the naturally occurring OATP2A1 protein. It is a transmembrane protein with 12 transmembrane domains and two cytoplasmic domains. The protein has a molecular weight of approximately 75 kDa and is glycosylated, meaning it has sugar molecules attached to it. These sugar molecules play a role in the protein’s stability and function.

Activity of Recombinant Human SLCO2A1 Protein

The main function of Recombinant Human SLCO2A1 Protein is to transport organic anions across the cell membrane. This includes a wide range of molecules, such as hormones, bile acids, and drugs. The protein has a high affinity for prostaglandins, which are important signaling molecules involved in inflammation and pain. This makes Recombinant Human SLCO2A1 Protein a valuable tool for studying the transport of prostaglandins and their role in various physiological processes.

In addition to its transport activity, Recombinant Human SLCO2A1 Protein also plays a role in drug metabolism. It is expressed in the liver, where it is involved in the uptake and elimination of drugs from the body. This makes it an important target for drug development and research.

Applications of Recombinant Human SLCO2A1 Protein

Recombinant Human SLCO2A1 Protein has a wide range of applications in both research and medicine. One of its main uses is in the study of drug transport and metabolism. By using this recombinant protein, researchers can better understand how drugs are transported into and out of cells, which can aid in the development of more effective and safe drugs.

Another important application of Recombinant Human SLCO2A1 Protein is in the development of new treatments for diseases. As mentioned earlier, this protein plays a role in inflammation and pain through its transport of prostaglandins. By studying this process, researchers can potentially develop new therapies for conditions such as arthritis, asthma, and inflammatory bowel disease.

Recombinant Human SLCO2A1 Protein also has potential applications in personalized medicine. Variations in the SLCO2A1 gene have been linked to differences in drug response and metabolism. By studying these variations and their effects on the protein, researchers can develop personalized treatment plans for individuals based on their genetic makeup.

Conclusion

In summary, Recombinant Human SLCO2A1 Protein is a synthetic version of the OATP2A1 protein that is involved in the transport of various molecules across cell membranes. Its structure is similar to the natural protein, and it has a high affinity for prostaglandins. This recombinant protein has numerous applications in research and medicine, including the study of drug transport and metabolism, the development of new treatments for diseases, and personalized medicine. Its use in these areas has the potential to greatly advance our understanding and treatment of various conditions.

Recombinant Human SLCO2A1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human SLCO2A1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products