Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SOCS6 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O14544
Molecular weight:
21.72 kDa

Original price was: $259.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Thr370–Tyr535
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SOCS6 Protein, N-His

Product name ARO-P10184-100
Uniprot ID O14544
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence TSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
Molecular weight 21.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr370-Tyr535
Aliases /Synonyms Suppressor of cytokine signaling 6, SOCS-6, Cytokine-inducible SH2 protein 4, CIS-4, Suppressor of cytokine signaling 4, SOCS-4, SOCS6, CIS4, SOCS4
Reference ARO-P10184
Note For research use only.
Molecular Constructor
Thr370–Tyr535
Product name ARO-P10184-1MG
Uniprot ID O14544
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence TSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
Molecular weight 21.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr370-Tyr535
Aliases /Synonyms Suppressor of cytokine signaling 6, SOCS-6, Cytokine-inducible SH2 protein 4, CIS-4, Suppressor of cytokine signaling 4, SOCS-4, SOCS6, CIS4, SOCS4
Reference ARO-P10184
Note For research use only.
Molecular Constructor
Thr370–Tyr535
Product name ARO-P10184-50
Uniprot ID O14544
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence TSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
Molecular weight 21.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr370-Tyr535
Aliases /Synonyms Suppressor of cytokine signaling 6, SOCS-6, Cytokine-inducible SH2 protein 4, CIS-4, Suppressor of cytokine signaling 4, SOCS-4, SOCS6, CIS4, SOCS4
Reference ARO-P10184
Note For research use only.
Molecular Constructor
Thr370–Tyr535

There are no reviews yet.

Be the first to review “Recombinant Human SOCS6 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products