Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SS18L1 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O75177
Molecular weight:
35.07 kDa

Original price was: $262.00.Current price is: $230.00.

50ug 12% OFF + 230 loyalty points
Thr17–Leu75
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SS18L1 Protein, N-GST & C-His

Product name ARO-P11362-100
Uniprot ID O75177
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TQQTIQKMLDENHHLIQCILEYQSKGKTAECTQYQQILHRNLVYLATIADSNQNMQSLL
Molecular weight 35.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr17-Leu75
Aliases /Synonyms Calcium-responsive transactivator, CREST, SS18-like protein 1, KIAA0693, SS18L1, SYT homolog 1
Reference ARO-P11362
Note For research use only.
Molecular Constructor
Thr17–Leu75
Product name ARO-P11362-1MG
Uniprot ID O75177
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TQQTIQKMLDENHHLIQCILEYQSKGKTAECTQYQQILHRNLVYLATIADSNQNMQSLL
Molecular weight 35.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr17-Leu75
Aliases /Synonyms Calcium-responsive transactivator, CREST, SS18-like protein 1, KIAA0693, SS18L1, SYT homolog 1
Reference ARO-P11362
Note For research use only.
Molecular Constructor
Thr17–Leu75
Product name ARO-P11362-50
Uniprot ID O75177
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TQQTIQKMLDENHHLIQCILEYQSKGKTAECTQYQQILHRNLVYLATIADSNQNMQSLL
Molecular weight 35.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr17-Leu75
Aliases /Synonyms Calcium-responsive transactivator, CREST, SS18-like protein 1, KIAA0693, SS18L1, SYT homolog 1
Reference ARO-P11362
Note For research use only.
Molecular Constructor
Thr17–Leu75

Introduction

Recombinant Human SS18L1 Protein, also known as SYT-like protein 1, is a protein that is encoded by the SS18L1 gene in humans. This protein belongs to the synovial sarcoma translocation (SS18) family and is involved in various cellular processes such as transcriptional regulation, cell proliferation, and differentiation. Recombinant Human SS18L1 Protein has gained significant attention in the scientific community due to its potential therapeutic applications in cancer and other diseases.

Structure of Recombinant Human SS18L1 Protein

The primary structure of Recombinant Human SS18L1 Protein consists of 481 amino acids, with a molecular weight of approximately 53 kDa. It contains a conserved N-terminal domain, a central acidic region, and a C-terminal domain. The N-terminal domain is responsible for protein-protein interactions, while the central acidic region contains a nuclear localization signal and multiple phosphorylation sites. The C-terminal domain is rich in proline and serine residues, which are important for protein folding and stability.

Activity of Recombinant Human SS18L1 Protein

Recombinant Human SS18L1 Protein is a transcriptional co-activator that plays a crucial role in chromatin remodeling and gene expression. It interacts with various transcription factors and co-activators, such as CREB-binding protein (CBP) and p300, to regulate gene expression. It also forms a complex with the BRD4 protein, which is involved in chromatin organization and transcriptional regulation.

Moreover, studies have shown that Recombinant Human SS18L1 Protein is involved in cell proliferation and differentiation. It has been found to be overexpressed in various types of cancer, including breast, lung, and colon cancer, suggesting its potential role in tumorigenesis. It has also been linked to the development of embryonic stem cells, indicating its importance in early embryonic development.

Application of Recombinant Human SS18L1 Protein

Due to its involvement in various cellular processes, Recombinant Human SS18L1 Protein has emerged as a potential therapeutic target in cancer and other diseases. It has been found to be overexpressed in several types of cancer, making it a promising candidate for targeted cancer therapies. Inhibitors of Recombinant Human SS18L1 Protein have been developed and are currently being tested in preclinical studies for their efficacy in cancer treatment.

Additionally, Recombinant Human SS18L1 Protein has also been studied for its role in stem cell development and differentiation. It has been found to be essential for the maintenance of pluripotency in embryonic stem cells and has potential applications in regenerative medicine.

Furthermore, Recombinant Human SS18L1 Protein has been identified as a potential biomarker for certain types of cancer. Its overexpression has been correlated with poor prognosis in breast and lung cancer patients, making it a potential diagnostic and prognostic marker for these diseases.

Conclusion

In conclusion, Recombinant Human SS18L1 Protein is a versatile protein with various roles in cellular processes such as transcriptional regulation, cell proliferation, and differentiation. Its structure, activity, and potential applications make it a promising candidate for targeted cancer therapies, regenerative medicine, and as a biomarker for certain types of cancer. Further research and clinical trials are needed to fully understand the potential of this protein and its therapeutic applications.

Recombinant Human SS18L1 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human SS18L1 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products