Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SUOX Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P51687
Molecular weight:
43.46 kDa

Original price was: $276.00.Current price is: $230.00.

50ug 17% OFF + 230 loyalty points
Val166–Pro545
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SUOX Protein, N-His

Product name ARO-P10393-100
Uniprot ID P51687
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVGAPGGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYVSP
Molecular weight 43.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val166-Pro545
Aliases /Synonyms Sulfite oxidase, mitochondrial, SUOX
Reference ARO-P10393
Note For research use only.
Molecular Constructor
Val166–Pro545
Product name ARO-P10393-1MG
Uniprot ID P51687
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVGAPGGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYVSP
Molecular weight 43.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val166-Pro545
Aliases /Synonyms Sulfite oxidase, mitochondrial, SUOX
Reference ARO-P10393
Note For research use only.
Molecular Constructor
Val166–Pro545
Product name ARO-P10393-50
Uniprot ID P51687
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVGAPGGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYVSP
Molecular weight 43.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val166-Pro545
Aliases /Synonyms Sulfite oxidase, mitochondrial, SUOX
Reference ARO-P10393
Note For research use only.
Molecular Constructor
Val166–Pro545

Introduction to Recombinant Human SUOX Protein

Recombinant Human SUOX Protein, also known as sulfite oxidase, is a key enzyme involved in the metabolism of sulfur-containing amino acids. It is a homodimeric protein that plays a crucial role in the detoxification of sulfite, a toxic byproduct of sulfur metabolism. The gene encoding for this protein is located on chromosome 12 and mutations in this gene have been linked to various disorders such as sulfite oxidase deficiency and molybdenum cofactor deficiency. In this article, we will discuss the structure, activity, and applications of Recombinant Human SUOX Protein.

Structure of Recombinant Human SUOX Protein

Recombinant Human SUOX Protein is composed of two identical subunits, each with a molecular weight of approximately 75 kDa. The primary structure of the protein consists of 524 amino acids, with a predicted molecular weight of 58.9 kDa. The protein contains a highly conserved molybdenum cofactor (Moco) binding domain, which is essential for its enzymatic activity. The crystal structure of Recombinant Human SUOX Protein has been determined, revealing a two-domain structure with a central core and an N-terminal domain that contains the Moco binding site.

Activity of Recombinant Human SUOX Protein

The main function of Recombinant Human SUOX Protein is to catalyze the conversion of sulfite to sulfate, using the Moco as a cofactor. This reaction is essential for the detoxification of sulfite, which is a byproduct of sulfur metabolism and can be toxic to cells. In addition to its role in sulfite detoxification, Recombinant Human SUOX Protein has also been shown to play a role in the metabolism of other sulfur-containing compounds, such as thiosulfate and cysteine.

Applications of Recombinant Human SUOX Protein

Recombinant Human SUOX Protein has various applications in both research and clinical settings. One of the main applications of this protein is in the diagnosis of sulfite oxidase deficiency and molybdenum cofactor deficiency. Mutations in the SUOX gene can lead to a deficiency in the enzyme, resulting in the accumulation of sulfite and other toxic metabolites in the body. Measurement of SUOX activity using recombinant protein can help in the diagnosis of these disorders.

Another application of Recombinant Human SUOX Protein is in the production of therapeutic agents. Sulfite oxidase deficiency is a rare inherited disorder that currently has no cure. However, research has shown that the administration of recombinant SUOX protein can improve the symptoms of this disorder. Recombinant SUOX protein can also be used in the development of drugs for other disorders related to sulfur metabolism, such as cystinuria and homocystinuria.

Furthermore, Recombinant Human SUOX Protein has been used in various studies to understand the role of sulfite oxidase in different biological processes. For example, it has been shown that SUOX activity is essential for the proper development of zebrafish embryos. Recombinant SUOX protein has also been used in studies to investigate the potential role of sulfite oxidase in the pathogenesis of diseases such as Alzheimer’s and Parkinson’s.

Conclusion

Recombinant Human SUOX Protein is a crucial enzyme involved in the detoxification of sulfite and other sulfur-containing compounds. Its structure and activity have been extensively studied, and it has various applications in both research and clinical settings. Recombinant SUOX protein has the potential to not only aid in the diagnosis and treatment of sulfite oxidase deficiency, but also in the development of therapeutics for other disorders related to sulfur metabolism. Further research on this protein may uncover new insights into its role in various biological processes and its potential as a therapeutic target for certain diseases.

Recombinant Human SUOX Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SUOX Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products