Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TACR2 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P21452
Molecular weight:
18.75 kDa

Original price was: $396.00.Current price is: $327.00.

100ug 17% OFF + 327 loyalty points
Asn311–Ser366
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TACR2 Protein, N-His-SUMO

Product name ARO-P11369-100
Uniprot ID P21452
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMAGDTAPS
Molecular weight 18.75 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn311-Ser366
Aliases /Synonyms NK-2 receptor, NKNAR, Neurokinin A receptor, SKR, Tachykinin receptor 2, TACR2, TAC2R, Substance-K receptor, NK2R, NK-2R
Reference ARO-P11369
Note For research use only.
Molecular Constructor
Asn311–Ser366
Product name ARO-P11369-1MG
Uniprot ID P21452
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMAGDTAPS
Molecular weight 18.75 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn311-Ser366
Aliases /Synonyms NK-2 receptor, NKNAR, Neurokinin A receptor, SKR, Tachykinin receptor 2, TACR2, TAC2R, Substance-K receptor, NK2R, NK-2R
Reference ARO-P11369
Note For research use only.
Molecular Constructor
Asn311–Ser366
Product name ARO-P11369-50
Uniprot ID P21452
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMAGDTAPS
Molecular weight 18.75 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn311-Ser366
Aliases /Synonyms NK-2 receptor, NKNAR, Neurokinin A receptor, SKR, Tachykinin receptor 2, TACR2, TAC2R, Substance-K receptor, NK2R, NK-2R
Reference ARO-P11369
Note For research use only.
Molecular Constructor
Asn311–Ser366

Introduction

The human body is a complex system of cells, tissues, and organs that work together to carry out various physiological processes. These processes are regulated by a network of signaling molecules, including proteins, that act as messengers between cells. One such protein is the recombinant human TACR2 protein, which plays a crucial role in the regulation of the immune and nervous systems. In this article, we will explore the structure, activity, and applications of this important protein.

Structure of Recombinant Human TACR2 Protein

The recombinant human TACR2 protein, also known as the neurokinin 2 receptor, is a member of the G protein-coupled receptor (GPCR) family. It is encoded by the TACR2 gene located on chromosome 2 in humans. The protein consists of 407 amino acids and has a molecular weight of approximately 46 kDa.

The TACR2 protein has a characteristic structure with seven transmembrane domains, an extracellular N-terminus, and an intracellular C-terminus. The extracellular N-terminus contains binding sites for its ligand, substance P, while the intracellular C-terminus is responsible for activating downstream signaling pathways.

Activity of Recombinant Human TACR2 Protein

The main function of the TACR2 protein is to bind to its ligand, substance P, and initiate a signaling cascade that leads to various physiological responses. Substance P is a neuropeptide that acts as a neurotransmitter and is involved in processes such as pain perception, inflammation, and immune response.

When substance P binds to the TACR2 protein, it triggers a conformational change that activates the G protein associated with the receptor. This, in turn, leads to the activation of downstream signaling pathways, including the phospholipase C (PLC) pathway and the mitogen-activated protein kinase (MAPK) pathway. These pathways regulate cellular processes such as calcium mobilization, gene expression, and cell proliferation.

Applications of Recombinant Human TACR2 Protein

Recombinant human TACR2 protein has a wide range of applications in both research and medicine. One of its primary uses is in the study of the immune system. The TACR2 protein is highly expressed in immune cells such as T cells, B cells, and macrophages, and its activation has been linked to the modulation of immune responses.

Moreover, the TACR2 protein has been implicated in various diseases, including autoimmune disorders, inflammatory diseases, and cancer. Its role in these diseases makes it a potential target for therapeutic interventions. Recombinant TACR2 protein can be used in drug discovery and development to screen for compounds that can modulate the activity of the receptor and potentially treat these diseases.

Additionally, recombinant TACR2 protein has been used in the development of diagnostic tools for various conditions. For example, in the field of pain management, the TACR2 protein has been targeted for the development of novel painkillers and diagnostic tests for pain-related disorders.

Conclusion

In summary, the recombinant human TACR2 protein is an essential component of the immune and nervous systems, and its role in regulating these systems makes it a crucial protein in maintaining overall health. Its structure, activity, and applications have been extensively studied, and ongoing research continues to uncover new insights into its functions and potential therapeutic applications. With its diverse range of functions, the TACR2 protein is a promising target for future research and development in various fields of medicine and biotechnology.

Recombinant Human TACR2 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human TACR2 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products