Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SLC17A1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q14916
Molecular weight:
18.13 kDa

Original price was: $257.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Ala211–Ser261
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SLC17A1 Protein, N-His-SUMO

Product name ARO-P11948-100
Uniprot ID Q14916
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AVCLLWFVLFYDDPKDHPCISISEKEYITSSLVQQVSSSRQSLPIKAILKS
Molecular weight 18.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala211-Ser261
Aliases /Synonyms NPT1, Renal sodium-phosphate transport protein 1, Renal sodium-dependent phosphate transport protein 1, Sodium-dependent phosphate transport protein 1, Renal Na(+)-dependent phosphate cotransporter 1, Sodium/phosphate cotransporter 1, Na(+)/PI cotransporter 1, Solute carrier family 17 member 1, Na/Pi-4, SLC17A1
Reference ARO-P11948
Note For research use only.
Molecular Constructor
Ala211–Ser261
Product name ARO-P11948-1MG
Uniprot ID Q14916
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AVCLLWFVLFYDDPKDHPCISISEKEYITSSLVQQVSSSRQSLPIKAILKS
Molecular weight 18.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala211-Ser261
Aliases /Synonyms NPT1, Renal sodium-phosphate transport protein 1, Renal sodium-dependent phosphate transport protein 1, Sodium-dependent phosphate transport protein 1, Renal Na(+)-dependent phosphate cotransporter 1, Sodium/phosphate cotransporter 1, Na(+)/PI cotransporter 1, Solute carrier family 17 member 1, Na/Pi-4, SLC17A1
Reference ARO-P11948
Note For research use only.
Molecular Constructor
Ala211–Ser261
Product name ARO-P11948-50
Uniprot ID Q14916
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AVCLLWFVLFYDDPKDHPCISISEKEYITSSLVQQVSSSRQSLPIKAILKS
Molecular weight 18.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala211-Ser261
Aliases /Synonyms NPT1, Renal sodium-phosphate transport protein 1, Renal sodium-dependent phosphate transport protein 1, Sodium-dependent phosphate transport protein 1, Renal Na(+)-dependent phosphate cotransporter 1, Sodium/phosphate cotransporter 1, Na(+)/PI cotransporter 1, Solute carrier family 17 member 1, Na/Pi-4, SLC17A1
Reference ARO-P11948
Note For research use only.
Molecular Constructor
Ala211–Ser261

Recombinant Human SLC17A1 Protein, also known as solute carrier family 17 member 1, is a protein that plays a crucial role in the transport of various molecules across cell membranes. This protein is encoded by the SLC17A1 gene and is found in many different tissues and cell types throughout the body. In this article, we will explore the structure, activity, and applications of this important protein.

Structure of Recombinant Human SLC17A1 Protein

The Recombinant Human SLC17A1 Protein is a transmembrane protein, meaning it spans the cell membrane and has both an intracellular and extracellular region. It is composed of 12 transmembrane domains, with the N-terminus located in the cytoplasm and the C-terminus located outside of the cell. The protein also contains two conserved motifs, known as the MFS (major facilitator superfamily) and the P-loop, which are important for its transport function.

The structure of this protein is highly conserved among different species, with a 97% amino acid sequence similarity between human and mouse SLC17A1 proteins. This highlights the importance of this protein in various biological processes.

Activity of Recombinant Human SLC17A1 Protein

The primary function of Recombinant Human SLC17A1 Protein is to transport small molecules, such as organic anions, across cell membranes. This is achieved through a process known as secondary active transport, where the protein uses the energy from the movement of other molecules to transport its substrate.

One of the main substrates of this protein is urate, a byproduct of purine metabolism. Recombinant Human SLC17A1 Protein is responsible for transporting urate out of cells, helping to maintain healthy levels in the body. Mutations in the SLC17A1 gene have been linked to hyperuricemia, a condition characterized by high levels of urate in the blood.

In addition to urate, Recombinant Human SLC17A1 Protein also transports other important molecules such as ascorbate (vitamin C) and glutamate, an important neurotransmitter in the brain. This highlights the diverse role of this protein in various physiological processes.

Applications of Recombinant Human SLC17A1 Protein

The unique structure and function of Recombinant Human SLC17A1 Protein make it a valuable tool in scientific research and medical applications. One of the main applications of this protein is in the study of urate metabolism and its role in diseases such as gout and kidney stones.

Recombinant Human SLC17A1 Protein is also used in drug development, as it is a target for drugs that aim to regulate urate levels. By understanding the structure and activity of this protein, researchers can design more effective and specific drugs to treat conditions related to urate metabolism.

Furthermore, Recombinant Human SLC17A1 Protein has potential therapeutic applications in the treatment of neurological disorders. As it is responsible for transporting glutamate, which plays a crucial role in brain function, this protein has been studied as a potential target for drugs to treat conditions such as Alzheimer’s disease and epilepsy.

In summary, Recombinant Human SLC17A1 Protein is a vital component of various physiological processes and has important applications in scientific research and medicine. Its unique structure and transport activity make it a valuable tool for understanding and treating diseases related to urate metabolism and neurological disorders.

Recombinant Human SLC17A1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human SLC17A1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products