Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TAX1BP1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q86VP1
Molecular weight:
17.41 kDa

Original price was: $296.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
His16–Lys146
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TAX1BP1 Protein, N-His

Product name ARO-P12262-100
Uniprot ID Q86VP1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTK
Molecular weight 17.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His16-Lys146
Aliases /Synonyms Tax1-binding protein 1, TAX1BP1, TRAF6-binding protein, T6BP
Reference ARO-P12262
Note For research use only.
Molecular Constructor
His16–Lys146
Product name ARO-P12262-1MG
Uniprot ID Q86VP1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTK
Molecular weight 17.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His16-Lys146
Aliases /Synonyms Tax1-binding protein 1, TAX1BP1, TRAF6-binding protein, T6BP
Reference ARO-P12262
Note For research use only.
Molecular Constructor
His16–Lys146
Product name ARO-P12262-50
Uniprot ID Q86VP1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTK
Molecular weight 17.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His16-Lys146
Aliases /Synonyms Tax1-binding protein 1, TAX1BP1, TRAF6-binding protein, T6BP
Reference ARO-P12262
Note For research use only.
Molecular Constructor
His16–Lys146

Introduction

Recombinant Human TAX1BP1 Protein, also known as Tax1-binding protein 1, is a 76-kDa protein that plays a crucial role in various cellular processes such as apoptosis, inflammation, and immune response. It is a member of the TAX1BP1 family, which consists of three closely related proteins – TAX1BP1, TAX1BP2, and TAX1BP3. This protein is encoded by the TAX1BP1 gene located on chromosome 7q11.23 and is highly conserved among different species.

Structure of Recombinant Human TAX1BP1 Protein

Recombinant Human TAX1BP1 Protein is composed of 690 amino acids and has a molecular weight of 76 kDa. It contains several structural domains, including an N-terminal ubiquitin-like domain (UBL), a C-terminal coiled-coil domain, and multiple WD40 repeats. The UBL domain is responsible for binding to ubiquitin and regulating protein-protein interactions, while the coiled-coil domain is involved in protein dimerization. The WD40 repeats are known to mediate protein-protein interactions and are essential for the function of TAX1BP1.

Activity of Recombinant Human TAX1BP1 Protein

Recombinant Human TAX1BP1 Protein is a multifunctional protein that acts as a negative regulator of the NF-κB signaling pathway. It interacts with the Tax1 protein of human T-cell leukemia virus type 1 (HTLV-1), which is a potent activator of NF-κB, and inhibits its activity. This interaction leads to the sequestration of Tax1 in the cytoplasm, preventing its translocation to the nucleus and subsequent activation of NF-κB.

Moreover, Recombinant Human TAX1BP1 Protein has been shown to play a role in the regulation of apoptosis. It interacts with several key proteins involved in apoptosis, such as Fas-associated death domain (FADD), caspase-8, and caspase-10, and inhibits their activation. This results in the inhibition of apoptosis and promotes cell survival.

In addition to its role in apoptosis and NF-κB signaling, Recombinant Human TAX1BP1 Protein has been implicated in the regulation of autophagy, a process by which cells degrade and recycle damaged or unnecessary cellular components. It interacts with the autophagy protein LC3 and regulates its localization and activity, thereby modulating the autophagy process.

Applications of Recombinant Human TAX1BP1 Protein

Recombinant Human TAX1BP1 Protein has various applications in both research and therapeutic settings. Its ability to regulate NF-κB signaling makes it a valuable tool for studying the role of this pathway in different cellular processes, such as inflammation and immune response. It can also be used to investigate the mechanisms of HTLV-1 infection and its association with diseases such as adult T-cell leukemia.

Furthermore, Recombinant Human TAX1BP1 Protein has potential therapeutic applications. As a negative regulator of NF-κB, it can be used to target diseases that involve dysregulated NF-κB signaling, such as autoimmune disorders and certain types of cancer. In addition, its role in apoptosis and autophagy makes it a potential target for the development of novel therapies for diseases characterized by abnormal cell death or survival.

Conclusion

In summary, Recombinant Human TAX1BP1 Protein is a multifunctional protein with diverse roles in cellular processes such as apoptosis, NF-κB signaling, and autophagy. Its structure, activity, and applications make it a valuable tool for studying and understanding various cellular processes and have potential therapeutic implications. Further research on this protein may lead to the development of new treatments for diseases associated with dysregulated NF-κB signaling and abnormal cell death.

Recombinant Human TAX1BP1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TAX1BP1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products