Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human VIRMA Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q69YN4
Molecular weight:
16.77 kDa

Original price was: $267.00.Current price is: $230.00.

50ug 14% OFF + 230 loyalty points
Met1–Arg130
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human VIRMA Protein, N-His

Product name ARO-P12171-100
Uniprot ID Q69YN4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAVDSAMELLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPPGVRAHSSLPDNRAYGETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSIIFRPNSKVNTDGLVLRGWYNCLTLAIYGSVDR
Molecular weight 16.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg130
Aliases /Synonyms KIAA1429, VIRMA, Protein virilizer homolog
Reference ARO-P12171
Note For research use only.
Molecular Constructor
Met1–Arg130
Product name ARO-P12171-1MG
Uniprot ID Q69YN4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAVDSAMELLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPPGVRAHSSLPDNRAYGETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSIIFRPNSKVNTDGLVLRGWYNCLTLAIYGSVDR
Molecular weight 16.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg130
Aliases /Synonyms KIAA1429, VIRMA, Protein virilizer homolog
Reference ARO-P12171
Note For research use only.
Molecular Constructor
Met1–Arg130
Product name ARO-P12171-50
Uniprot ID Q69YN4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAVDSAMELLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPPGVRAHSSLPDNRAYGETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSIIFRPNSKVNTDGLVLRGWYNCLTLAIYGSVDR
Molecular weight 16.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg130
Aliases /Synonyms KIAA1429, VIRMA, Protein virilizer homolog
Reference ARO-P12171
Note For research use only.
Molecular Constructor
Met1–Arg130

Introduction

Recombinant Human VIRMA Protein, also known as KIAA1964, is a protein that is encoded by the Virm gene in humans. It is a 1,550 amino acid protein with a molecular weight of approximately 176 kDa. This protein plays a crucial role in epigenetic regulation and has been linked to various diseases, making it a promising target for therapeutic interventions.

Structure of Recombinant Human VIRMA Protein

The structure of Recombinant Human VIRMA Protein is composed of several functional domains, including a methyltransferase domain, a zinc finger domain, and a PHD finger domain. The methyltransferase domain is responsible for the catalytic activity of the protein, while the zinc finger and PHD finger domains are involved in DNA binding and protein-protein interactions, respectively.

The protein also contains multiple phosphorylation sites, which play a role in regulating its activity. Additionally, it has been found to form complexes with other proteins, such as the histone methyltransferase complex, which further modulates its function.

Activity of Recombinant Human VIRMA Protein

Recombinant Human VIRMA Protein is a histone methyltransferase, meaning it catalyzes the addition of methyl groups to specific amino acids on histone proteins. This activity is essential for the epigenetic regulation of gene expression, as it can alter the structure of chromatin and affect the accessibility of DNA to transcription factors.

Studies have shown that Recombinant Human VIRMA Protein primarily methylates histone H3 at lysine 36 (H3K36), a modification associated with transcriptional activation. It has also been found to methylate other histone proteins, such as H3K4 and H3K79, indicating its role in regulating multiple gene expression pathways.

Application of Recombinant Human VIRMA Protein

Due to its involvement in epigenetic regulation, Recombinant Human VIRMA Protein has been linked to various diseases, making it a potential therapeutic target. For instance, it has been found to play a role in the development and progression of cancer, as its overexpression has been observed in multiple cancer types.

Furthermore, studies have shown that Recombinant Human VIRMA Protein is essential for the maintenance of embryonic stem cells and the development of the central nervous system. Therefore, it has also been implicated in neurodegenerative disorders and developmental disorders, such as autism spectrum disorders.

The use of Recombinant Human VIRMA Protein as a diagnostic tool has also been explored. Its overexpression has been associated with poor prognosis in certain cancers, making it a potential biomarker for disease progression and treatment response.

Conclusion

In conclusion, Recombinant Human VIRMA Protein is a multifunctional protein that plays a crucial role in epigenetic regulation. Its structure, activity, and potential applications make it a promising target for therapeutic interventions and diagnostic purposes. Further research on this protein is needed to fully understand its role in various diseases and to develop effective treatments targeting its activity.

Recombinant Human VIRMA Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human VIRMA Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products