Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse AMIGO1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q80ZD8
Molecular weight:
29.37 kDa

Original price was: $267.00.Current price is: $230.00.

50ug 14% OFF + 230 loyalty points
Asn37–Asn269
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse AMIGO1 Protein, N-His

Product name ARO-P10509-100
Uniprot ID Q80ZD8
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NCLCASNILSCSKQQLPNVPQSLPSYTALLDLSHNNLSRLRAEWTPTRLTNLHSLLLSHNHLNFISSEAFVPVPNLRYLDLSSNHLHTLDEFLFSDLQALEVLLLYNNHIVVVDRNAFEDMAQLQKLYLSQNQISRFPVELIKDGNKLPKLMLLDLSSNKLKKLPLTDLQKLPAWVKNGLYLHNNPLECDCKLYQLFSHWQYRQLSSVMDFQEDLYCMHSKKLHNIFSLDFFN
Molecular weight 29.37 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn37-Asn269
Aliases /Synonyms AMIGO, AMIGO1, Amphoterin-induced protein 1, AMIGO-1, KIAA1163, Alivin-2, ALI2
Reference ARO-P10509
Note For research use only.
Molecular Constructor
Asn37–Asn269
Product name ARO-P10509-1MG
Uniprot ID Q80ZD8
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NCLCASNILSCSKQQLPNVPQSLPSYTALLDLSHNNLSRLRAEWTPTRLTNLHSLLLSHNHLNFISSEAFVPVPNLRYLDLSSNHLHTLDEFLFSDLQALEVLLLYNNHIVVVDRNAFEDMAQLQKLYLSQNQISRFPVELIKDGNKLPKLMLLDLSSNKLKKLPLTDLQKLPAWVKNGLYLHNNPLECDCKLYQLFSHWQYRQLSSVMDFQEDLYCMHSKKLHNIFSLDFFN
Molecular weight 29.37 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn37-Asn269
Aliases /Synonyms AMIGO, AMIGO1, Amphoterin-induced protein 1, AMIGO-1, KIAA1163, Alivin-2, ALI2
Reference ARO-P10509
Note For research use only.
Molecular Constructor
Asn37–Asn269
Product name ARO-P10509-50
Uniprot ID Q80ZD8
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NCLCASNILSCSKQQLPNVPQSLPSYTALLDLSHNNLSRLRAEWTPTRLTNLHSLLLSHNHLNFISSEAFVPVPNLRYLDLSSNHLHTLDEFLFSDLQALEVLLLYNNHIVVVDRNAFEDMAQLQKLYLSQNQISRFPVELIKDGNKLPKLMLLDLSSNKLKKLPLTDLQKLPAWVKNGLYLHNNPLECDCKLYQLFSHWQYRQLSSVMDFQEDLYCMHSKKLHNIFSLDFFN
Molecular weight 29.37 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn37-Asn269
Aliases /Synonyms AMIGO, AMIGO1, Amphoterin-induced protein 1, AMIGO-1, KIAA1163, Alivin-2, ALI2
Reference ARO-P10509
Note For research use only.
Molecular Constructor
Asn37–Asn269

Introduction

Recombinant Mouse AMIGO1 Protein is a highly purified protein that is produced through recombinant DNA technology. This protein is an important member of the AMIGO family of proteins, which are involved in cell adhesion and signaling pathways. In this article, we will discuss the structure, activity, and applications of Recombinant Mouse AMIGO1 Protein.

Structure of Recombinant Mouse AMIGO1 Protein

The recombinant form of Mouse AMIGO1 Protein is a homodimer, meaning it is composed of two identical subunits. Each subunit has a molecular weight of approximately 65 kDa and contains 572 amino acids. The protein has a transmembrane domain, a large extracellular domain, and a short cytoplasmic domain. The extracellular domain contains several immunoglobulin-like domains, which are important for protein-protein interactions.

Activity of Recombinant Mouse AMIGO1 Protein

Recombinant Mouse AMIGO1 Protein is primarily involved in cell adhesion and signaling. It has been shown to interact with other AMIGO family members, as well as other proteins such as neurexins and contactins. These interactions play a crucial role in the formation and maintenance of neuronal networks.

In addition, Recombinant Mouse AMIGO1 Protein has been found to have a role in the regulation of neurite outgrowth and synapse formation. It has been shown to promote the growth of neurites, which are projections from neurons that allow them to communicate with other cells. This activity is important for the development and function of the nervous system.

Applications of Recombinant Mouse AMIGO1 Protein

Recombinant Mouse AMIGO1 Protein has a wide range of applications in both research and clinical settings. One of its main uses is in the study of neuronal development and function. By studying the interactions and activity of this protein, researchers can gain a better understanding of how neurons form connections and communicate with each other.

Furthermore, Recombinant Mouse AMIGO1 Protein has potential therapeutic applications. It has been shown to have a role in the regulation of neuronal plasticity, which is the ability of the brain to change and adapt. This could be beneficial in treating neurological disorders such as Alzheimer’s disease and Parkinson’s disease, which are characterized by impaired neuronal plasticity.

Moreover, Recombinant Mouse AMIGO1 Protein has been found to be a potential target for drug development. By understanding its structure and activity, researchers can design drugs that specifically target this protein, potentially leading to new treatments for neurological disorders.

Conclusion

Recombinant Mouse AMIGO1 Protein is a crucial protein involved in cell adhesion and signaling pathways. Its structure and activity have been extensively studied, and it has a wide range of applications in research and potential therapeutic uses. Further research on this protein could lead to a better understanding of neuronal development and function, as well as the development of new treatments for neurological disorders.

Keywords:

Recombinant protein, antigen, AMIGO1, cell adhesion, signaling, neuronal development, neurite outgrowth, synapse formation, neuronal plasticity, drug development.

Recombinant Mouse AMIGO1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse AMIGO1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products