Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse APOE Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P08226
Molecular weight:
23.31 kDa

Original price was: $350.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Gly20–Gln200
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse APOE Protein, N-His

Product name ARO-P10609-100
Uniprot ID P08226
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQ
Molecular weight 23.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly20-Gln200
Aliases /Synonyms Apo-E, Apolipoprotein E, APOE
Reference ARO-P10609
Note For research use only.
Molecular Constructor
Gly20–Gln200
Product name ARO-P10609-1MG
Uniprot ID P08226
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQ
Molecular weight 23.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly20-Gln200
Aliases /Synonyms Apo-E, Apolipoprotein E, APOE
Reference ARO-P10609
Note For research use only.
Molecular Constructor
Gly20–Gln200
Product name ARO-P10609-50
Uniprot ID P08226
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQ
Molecular weight 23.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly20-Gln200
Aliases /Synonyms Apo-E, Apolipoprotein E, APOE
Reference ARO-P10609
Note For research use only.
Molecular Constructor
Gly20–Gln200

Introduction to Recombinant Mouse APOE Protein

Recombinant Mouse APOE Protein is a highly purified form of the apolipoprotein E (APOE) protein that is produced using recombinant DNA technology. APOE is a protein that plays a crucial role in lipid metabolism and is primarily found in the brain and liver. The recombinant form of this protein has been widely used in various research studies and has shown promising results in the treatment of various diseases.

Structure of Recombinant Mouse APOE Protein

Recombinant Mouse APOE Protein is a 299 amino acid protein with a molecular weight of approximately 34 kDa. It is composed of two domains, an N-terminal domain and a C-terminal domain, connected by a hinge region. The N-terminal domain contains a lipid-binding region, while the C-terminal domain is responsible for receptor binding. The protein also contains two cysteine residues that form a disulfide bond, contributing to its stability.

Activity of Recombinant Mouse APOE Protein

Recombinant Mouse APOE Protein plays a crucial role in lipid metabolism by facilitating the transport and metabolism of lipoproteins. It acts as a ligand for the low-density lipoprotein (LDL) receptor, binding to it and promoting the uptake of LDL cholesterol into cells. It also interacts with other receptors, such as the very-low-density lipoprotein (VLDL) receptor and the LDL receptor-related protein (LRP), to regulate lipid metabolism.

In addition to its role in lipid metabolism, recombinant APOE has also been shown to have neuroprotective and anti-inflammatory properties. It has been found to play a crucial role in maintaining the integrity of the blood-brain barrier, and studies have shown that it can protect against neurodegenerative diseases such as Alzheimer’s disease.

Application of Recombinant Mouse APOE Protein

Recombinant Mouse APOE Protein has a wide range of applications in both research and therapeutic settings. In research, it is commonly used as a tool to study the role of APOE in various diseases, including cardiovascular disease, Alzheimer’s disease, and atherosclerosis. Its ability to bind to different receptors also makes it a valuable tool for studying lipid metabolism and transport.

In therapeutic settings, recombinant APOE has shown promising results in the treatment of various diseases. It has been studied as a potential treatment for Alzheimer’s disease, as it has been found to have neuroprotective properties and can help prevent the formation of amyloid plaques in the brain. It has also been investigated as a potential therapy for atherosclerosis, as it can regulate lipid metabolism and promote the clearance of cholesterol from the blood.

Conclusion

Recombinant Mouse APOE Protein is a highly purified form of the APOE protein that has been produced using recombinant DNA technology. Its structure, activity, and applications make it a valuable tool in both research and therapeutic settings. Its role in lipid metabolism and its neuroprotective and anti-inflammatory properties make it a promising candidate for the treatment of various diseases. Further research and development of this protein may lead to new and effective treatments for diseases such as Alzheimer’s and atherosclerosis.

Recombinant Mouse APOE Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse APOE Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products