Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD244 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q07763
Molecular weight:
23.66 kDa

Original price was: $345.00.Current price is: $274.00.

50ug 21% OFF + 274 loyalty points
Asp24–Thr212
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD244 Protein, N-His

Product name ARO-P10561-100
Uniprot ID Q07763
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILDHVETPNLKAQWKPWTNGTCQLFLSCLVTKDDNVSYALYRGSTLISNQRNSTHWENQIDASSLHTYTCNVSNRASWANHTLNFT
Molecular weight 23.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp24-Thr212
Aliases /Synonyms SLAM family member 4, SLAMF4, h2B4, Signaling lymphocytic activation molecule 4, Natural killer cell receptor 2B4, NKR2B4, NAIL, NK cell type I receptor protein 2B4, CD244, NK cell activation-inducing ligand, 2B4
Reference ARO-P10561
Note For research use only.
Molecular Constructor
Asp24–Thr212
Product name ARO-P10561-1MG
Uniprot ID Q07763
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILDHVETPNLKAQWKPWTNGTCQLFLSCLVTKDDNVSYALYRGSTLISNQRNSTHWENQIDASSLHTYTCNVSNRASWANHTLNFT
Molecular weight 23.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp24-Thr212
Aliases /Synonyms SLAM family member 4, SLAMF4, h2B4, Signaling lymphocytic activation molecule 4, Natural killer cell receptor 2B4, NKR2B4, NAIL, NK cell type I receptor protein 2B4, CD244, NK cell activation-inducing ligand, 2B4
Reference ARO-P10561
Note For research use only.
Molecular Constructor
Asp24–Thr212
Product name ARO-P10561-50
Uniprot ID Q07763
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILDHVETPNLKAQWKPWTNGTCQLFLSCLVTKDDNVSYALYRGSTLISNQRNSTHWENQIDASSLHTYTCNVSNRASWANHTLNFT
Molecular weight 23.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp24-Thr212
Aliases /Synonyms SLAM family member 4, SLAMF4, h2B4, Signaling lymphocytic activation molecule 4, Natural killer cell receptor 2B4, NKR2B4, NAIL, NK cell type I receptor protein 2B4, CD244, NK cell activation-inducing ligand, 2B4
Reference ARO-P10561
Note For research use only.
Molecular Constructor
Asp24–Thr212

Introduction to Recombinant Mouse CD244 Protein

Recombinant Mouse CD244 Protein, also known as CD244 antigen, is a transmembrane protein that belongs to the signaling lymphocyte activation molecule (SLAM) family. This protein is encoded by the Cd244 gene and is predominantly expressed on the surface of natural killer (NK) cells, CD8+ T cells, and a subset of CD4+ T cells. It plays a crucial role in regulating immune responses and is involved in various cellular processes such as cell proliferation, cytokine production, and cytotoxicity.

Structure of Recombinant Mouse CD244 Protein

The Recombinant Mouse CD244 Protein is a type I transmembrane protein with a molecular weight of approximately 50 kDa. It consists of a single extracellular domain, a transmembrane domain, and a cytoplasmic tail. The extracellular domain of CD244 contains two immunoglobulin (Ig)-like domains, a variable (V)-type Ig-like domain and a constant (C)-type Ig-like domain. These domains are responsible for the binding of CD244 to its ligands.

The cytoplasmic tail of CD244 contains several conserved tyrosine residues that are involved in signaling. Upon binding to its ligands, CD244 undergoes phosphorylation of these tyrosine residues, leading to the recruitment of signaling molecules and activation of downstream signaling pathways.

Activity of Recombinant Mouse CD244 Protein

The main function of Recombinant Mouse CD244 Protein is to regulate the activity of immune cells. It can act as both an activating and inhibitory receptor, depending on the type of immune cell it is expressed on and the ligand it binds to.

When CD244 is expressed on NK cells, it acts as an activating receptor and promotes NK cell-mediated cytotoxicity against target cells. This is achieved by the binding of CD244 to its ligands, such as CD48 and CD150, on target cells, leading to the activation of NK cells and the release of cytotoxic molecules.

On the other hand, when CD244 is expressed on T cells, it acts as an inhibitory receptor and regulates T cell activation. This is achieved by the binding of CD244 to its ligands, such as CD48 and CD150, on antigen-presenting cells (APCs), leading to the inhibition of T cell proliferation and cytokine production.

Application of Recombinant Mouse CD244 Protein

Recombinant Mouse CD244 Protein has various applications in both research and clinical settings. One of the main applications of this protein is in the study of immune responses and immune-mediated diseases. By studying the binding of CD244 to its ligands and the downstream signaling pathways, researchers can gain a better understanding of the role of CD244 in regulating immune responses and its potential role in diseases such as cancer and autoimmune disorders.

In addition, Recombinant Mouse CD244 Protein can also be used in the development of immunotherapies. By targeting CD244 and modulating its activity, it is possible to enhance or suppress immune responses, making it a potential target for the treatment of various diseases. Furthermore, the use of CD244-specific antibodies or recombinant proteins can also be used as diagnostic tools for the detection of immune cell activity and dysfunction.

Conclusion

Recombinant Mouse CD244 Protein is a transmembrane protein that plays a crucial role in regulating immune responses. Its structure, activity, and applications make it a valuable protein in the study of immune-mediated diseases and the development of immunotherapies. Further research on this protein may lead to new insights and potential treatments for various diseases.

Recombinant Mouse CD244 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD244 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products