Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse NRTN Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P97463
Molecular weight:
23.64 kDa

Original price was: $309.00.Current price is: $274.00.

50ug 11% OFF + 274 loyalty points
Arg99–Val195
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse NRTN Protein, N-His-SUMO

Product name ARO-P10568-100
Uniprot ID P97463
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence RPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV
Molecular weight 23.64 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg99-Val195
Aliases /Synonyms NRTN, Neurturin
Reference ARO-P10568
Note For research use only.
Molecular Constructor
Arg99–Val195
Product name ARO-P10568-1MG
Uniprot ID P97463
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence RPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV
Molecular weight 23.64 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg99-Val195
Aliases /Synonyms NRTN, Neurturin
Reference ARO-P10568
Note For research use only.
Molecular Constructor
Arg99–Val195
Product name ARO-P10568-50
Uniprot ID P97463
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence RPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYDLGLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV
Molecular weight 23.64 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg99-Val195
Aliases /Synonyms NRTN, Neurturin
Reference ARO-P10568
Note For research use only.
Molecular Constructor
Arg99–Val195

Introduction

Recombinant Mouse NRTN Protein (Neurturin) is a novel neurotrophic factor that belongs to the glial cell line-derived neurotrophic factor (GDNF) family. It is a 13 kDa protein that is highly conserved across species and plays a crucial role in the development and maintenance of the nervous system. In this article, we will discuss the structure, activity, and applications of recombinant mouse NRTN protein.

Structure of Recombinant Mouse NRTN Protein

Recombinant mouse NRTN protein is produced by recombinant DNA technology and is a homodimeric protein consisting of two identical subunits. Each subunit contains 120 amino acids and has a molecular weight of approximately 13 kDa. The crystal structure of recombinant mouse NRTN protein has been determined, revealing a unique fold with a central beta-sheet surrounded by alpha-helices. This structure is similar to other members of the GDNF family, such as GDNF and Artemin, but has distinct differences in the amino acid sequence.

Activity of Recombinant Mouse NRTN Protein

Recombinant mouse NRTN protein exerts its activity by binding to the GDNF family receptor alpha-2 (GFRα2) and the receptor tyrosine kinase RET. This binding leads to the activation of the RET signaling pathway, which plays a crucial role in the development and survival of dopaminergic neurons in the central nervous system. It also has neurotrophic effects on other neuronal populations, including motor neurons, sensory neurons, and sympathetic neurons.

In addition to its neurotrophic activity, recombinant mouse NRTN protein has been shown to have anti-inflammatory and immunomodulatory effects. It can inhibit the production of pro-inflammatory cytokines and promote the production of anti-inflammatory cytokines, making it a potential therapeutic agent for neuroinflammatory diseases.

Applications of Recombinant Mouse NRTN Protein

Recombinant mouse NRTN protein has been extensively studied for its potential therapeutic applications in various neurological disorders. Its neurotrophic activity makes it a promising candidate for the treatment of neurodegenerative diseases, such as Parkinson’s disease and amyotrophic lateral sclerosis (ALS). Studies have shown that recombinant mouse NRTN protein can protect dopaminergic neurons from degeneration and promote their survival in animal models of Parkinson’s disease.

In addition to its neuroprotective effects, recombinant mouse NRTN protein has also been investigated for its potential in promoting nerve regeneration. It has been shown to enhance the survival and growth of damaged neurons, making it a potential treatment for nerve injuries and peripheral neuropathies.

Furthermore, recombinant mouse NRTN protein has shown promising results in preclinical studies for the treatment of multiple sclerosis (MS). It has been shown to reduce inflammation and promote remyelination, which could potentially slow down the progression of the disease and improve symptoms.

Apart from its therapeutic applications, recombinant mouse NRTN protein has also been used in research for studying the role of neurotrophic factors in the development and maintenance of the nervous system. It has been used to investigate the mechanisms underlying neurodegenerative diseases and to identify potential therapeutic targets.

Conclusion

In conclusion, recombinant mouse NRTN protein is a unique neurotrophic factor with diverse biological activities. Its structure, activity, and potential applications make it a promising candidate for the treatment of various neurological disorders. Further research and clinical trials are needed to fully understand its therapeutic potential and to develop effective treatments using this protein.

Recombinant Mouse NRTN Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse NRTN Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products