Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse BID Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P70444
Molecular weight:
23.48 kDa

Original price was: $294.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Gly8–Asp195
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse BID Protein, N-His

Product name ARO-P10569-100
Uniprot ID P70444
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD
Molecular weight 23.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly8-Asp195
Aliases /Synonyms BH3-interacting domain death agonist, p11 BID, p13 BID, p15 BID, BID, p22 BID
Reference ARO-P10569
Note For research use only.
Molecular Constructor
Gly8–Asp195
Product name ARO-P10569-1MG
Uniprot ID P70444
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD
Molecular weight 23.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly8-Asp195
Aliases /Synonyms BH3-interacting domain death agonist, p11 BID, p13 BID, p15 BID, BID, p22 BID
Reference ARO-P10569
Note For research use only.
Molecular Constructor
Gly8–Asp195
Product name ARO-P10569-50
Uniprot ID P70444
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD
Molecular weight 23.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly8-Asp195
Aliases /Synonyms BH3-interacting domain death agonist, p11 BID, p13 BID, p15 BID, BID, p22 BID
Reference ARO-P10569
Note For research use only.
Molecular Constructor
Gly8–Asp195

Introduction

Recombinant proteins are proteins that are produced through the use of recombinant DNA technology, which involves inserting a desired gene into a host organism, such as bacteria or yeast, to produce large quantities of the desired protein. Among the various recombinant proteins, Recombinant Mouse BID Protein has gained significant attention in the scientific community due to its unique structure, diverse activity, and potential applications in various fields.

Structure of Recombinant Mouse BID Protein

Recombinant Mouse BID Protein, also known as BH3-interacting domain death agonist, is a member of the Bcl-2 protein family. It is a 22 kDa protein consisting of 195 amino acids and is encoded by the Bid gene located on chromosome 6 in mice. The protein contains a BH3 domain, which is responsible for its pro-apoptotic activity, and a C-terminal transmembrane domain, which anchors it to the mitochondrial membrane.

Activity of Recombinant Mouse BID Protein

Recombinant Mouse BID Protein is primarily involved in the regulation of apoptosis, or programmed cell death. It acts as a pro-apoptotic protein by promoting the release of cytochrome c from the mitochondria, which triggers the activation of caspases, a family of proteases that carry out the process of apoptosis. This activity of Recombinant Mouse BID Protein is regulated by its interaction with other Bcl-2 family proteins, such as Bax and Bak, and is essential for maintaining the balance between cell survival and death.

In addition to its role in apoptosis, Recombinant Mouse BID Protein has also been shown to play a role in other cellular processes, such as autophagy and mitophagy. It has been reported that Recombinant Mouse BID Protein can induce autophagy by interacting with the autophagy regulator, Beclin-1. Furthermore, studies have shown that Recombinant Mouse BID Protein can also promote mitophagy, a process that involves the selective degradation of damaged mitochondria, thereby maintaining cellular homeostasis.

Applications of Recombinant Mouse BID Protein

Recombinant Mouse BID Protein has a wide range of potential applications in various fields, including cancer research, drug development, and biotechnology. Its pro-apoptotic activity makes it a promising target for cancer therapy, as dysregulation of apoptosis is a hallmark of cancer. Studies have shown that Recombinant Mouse BID Protein can sensitize cancer cells to chemotherapeutic drugs, making it a potential adjuvant in cancer treatment.

Moreover, Recombinant Mouse BID Protein has also been investigated as a potential therapeutic agent for neurodegenerative diseases, such as Alzheimer’s and Parkinson’s disease. Its ability to induce autophagy and mitophagy may play a crucial role in the clearance of toxic protein aggregates, which are characteristic of these diseases.

In the field of biotechnology, Recombinant Mouse BID Protein has been used as an antigen in various experimental studies. Its pro-apoptotic activity has been exploited to design novel cancer vaccines, which can stimulate the immune system to target cancer cells. Furthermore, Recombinant Mouse BID Protein has also been used as a tool in protein-protein interaction studies, providing insights into the complex regulatory networks involved in apoptosis and other cellular processes.

Conclusion

In summary, Recombinant Mouse BID Protein is a unique protein with a diverse range of activities and potential applications. Its structure, activity, and potential therapeutic and biotechnological applications make it a promising candidate for further research and development. With ongoing studies and advancements in recombinant DNA technology, the potential of Recombinant Mouse BID Protein is yet to be fully explored, and it holds great promise for future scientific discoveries.

SDS-PAGE for Recombinant Mouse BID Protein, N-His

SDS-PAGE for Recombinant Mouse BID Protein, N-His

Recombinant Mouse BID Protein, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Mouse BID Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse BID Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products