Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P25119
Molecular weight:
29.27 kDa

Original price was: $312.00.Current price is: $274.00.

50ug 12% OFF + 274 loyalty points
Ser43–Asp199
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein, N-His-SUMO

Product name ARO-P11095-100
Uniprot ID P25119
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTD
Molecular weight 29.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser43-Asp199
Aliases /Synonyms TNF-R2, TNFR-II, p80 TNF-alpha receptor, Etanercept, TNFBR, TBP-2, TBPII, Tumor necrosis factor receptor superfamily member 1B, CD120b, p75, TNFRSF1B, Tumor necrosis factor receptor 2, TNF-RII, TNFR2, Tumor necrosis factor receptor type II
Reference ARO-P11095
Note For research use only.
Molecular Constructor
Ser43–Asp199
Product name ARO-P11095-1MG
Uniprot ID P25119
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTD
Molecular weight 29.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser43-Asp199
Aliases /Synonyms TNF-R2, TNFR-II, p80 TNF-alpha receptor, Etanercept, TNFBR, TBP-2, TBPII, Tumor necrosis factor receptor superfamily member 1B, CD120b, p75, TNFRSF1B, Tumor necrosis factor receptor 2, TNF-RII, TNFR2, Tumor necrosis factor receptor type II
Reference ARO-P11095
Note For research use only.
Molecular Constructor
Ser43–Asp199
Product name ARO-P11095-50
Uniprot ID P25119
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTD
Molecular weight 29.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser43-Asp199
Aliases /Synonyms TNF-R2, TNFR-II, p80 TNF-alpha receptor, Etanercept, TNFBR, TBP-2, TBPII, Tumor necrosis factor receptor superfamily member 1B, CD120b, p75, TNFRSF1B, Tumor necrosis factor receptor 2, TNF-RII, TNFR2, Tumor necrosis factor receptor type II
Reference ARO-P11095
Note For research use only.
Molecular Constructor
Ser43–Asp199

Introduction

Recombinant Mouse CD120b, also known as TNFRSF1B or TNFR2, is a protein that plays a crucial role in the immune system. It belongs to the tumor necrosis factor receptor superfamily and is a key mediator of cell signaling and inflammation. In this article, we will explore the structure, activity, and application of this important recombinant protein.

Structure of Recombinant Mouse CD120b

Recombinant Mouse CD120b is a transmembrane protein consisting of 461 amino acids. It is composed of an extracellular domain, a transmembrane domain, and an intracellular domain. The extracellular domain contains four cysteine-rich repeats, which are responsible for binding to its ligand, tumor necrosis factor (TNF). The transmembrane domain anchors the protein to the cell membrane, while the intracellular domain is involved in signal transduction.

Activity of Recombinant Mouse CD120b

The main function of Recombinant Mouse CD120b is to act as a receptor for TNF, a pro-inflammatory cytokine. Upon binding to TNF, CD120b undergoes a conformational change, leading to the activation of downstream signaling pathways. This results in the production of various cytokines and chemokines, leading to inflammation and immune response.

Apart from its role in inflammation, Recombinant Mouse CD120b also plays a crucial role in cell survival and apoptosis. It has been shown to regulate cell death by activating the NF-κB pathway, which promotes cell survival, or the JNK pathway, which induces apoptosis. This dual role of CD120b in cell survival and death makes it a critical regulator of tissue homeostasis and immune response.

Application of Recombinant Mouse CD120b

Recombinant Mouse CD120b has a wide range of applications in both research and therapeutic settings. One of its primary uses is in studying the role of TNF in various diseases, including autoimmune disorders, infectious diseases, and cancer. By blocking the interaction between TNF and CD120b, researchers can better understand the mechanisms of TNF-mediated inflammation and develop new treatments for these diseases.

In addition to its research applications, Recombinant Mouse CD120b has also been used in therapeutic settings. It has been shown to be effective in treating autoimmune diseases such as rheumatoid arthritis and Crohn’s disease. By blocking the activity of TNF, which is known to be elevated in these diseases, CD120b can reduce inflammation and alleviate symptoms.

Moreover, Recombinant Mouse CD120b has also been used in cancer treatment. TNF has been shown to play a role in tumor growth and metastasis, and by targeting CD120b, researchers can inhibit TNF-mediated signaling and potentially slow down tumor progression. This makes CD120b a promising target for cancer therapy.

Conclusion

In conclusion, Recombinant Mouse CD120b is a key player in the immune system, acting as a receptor for the pro-inflammatory cytokine TNF. Its structure, activity, and application have been extensively studied, and it has been shown to have a crucial role in inflammation, cell survival, and apoptosis. Its wide range of applications in research and therapy makes it a valuable tool in understanding and treating various diseases. Further research on this protein may lead to new insights and potential treatments for a range of conditions.

Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse CD120b/TNFRSF1B/TNFR2 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products