Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD16/FcRIII Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P08508
Molecular weight:
22.24 kDa

Original price was: $307.00.Current price is: $274.00.

50ug 11% OFF + 274 loyalty points
Ala35–Ser209
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD16/FcRIII Protein, N-His

Product name ARO-P11114-100
Uniprot ID P08508
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence AVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSIS
Molecular weight 22.24 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala35-Ser209
Aliases /Synonyms FcRIII, IgG Fc receptor III, Low affinity immunoglobulin gamma Fc region receptor III, Fcgr3, Fc-gamma RIII, CD16
Reference ARO-P11114
Note For research use only.
Molecular Constructor
Ala35–Ser209
Product name ARO-P11114-1MG
Uniprot ID P08508
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence AVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSIS
Molecular weight 22.24 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala35-Ser209
Aliases /Synonyms FcRIII, IgG Fc receptor III, Low affinity immunoglobulin gamma Fc region receptor III, Fcgr3, Fc-gamma RIII, CD16
Reference ARO-P11114
Note For research use only.
Molecular Constructor
Ala35–Ser209
Product name ARO-P11114-50
Uniprot ID P08508
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence AVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSIS
Molecular weight 22.24 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala35-Ser209
Aliases /Synonyms FcRIII, IgG Fc receptor III, Low affinity immunoglobulin gamma Fc region receptor III, Fcgr3, Fc-gamma RIII, CD16
Reference ARO-P11114
Note For research use only.
Molecular Constructor
Ala35–Ser209

Introduction

Recombinant proteins have become an essential tool in biomedical research, drug development, and clinical applications. One such protein is the Recombinant Mouse CD16/FcRIII Protein, which has gained significant attention due to its structure, activity, and diverse applications. In this article, we will provide a detailed description of this protein, including its structure, function, and applications.

Structure of Recombinant Mouse CD16/FcRIII Protein

Recombinant Mouse CD16/FcRIII Protein is a glycoprotein that belongs to the immunoglobulin superfamily. It is composed of two subunits, the alpha and gamma chains, and is encoded by the Fcgr3 gene. The alpha chain contains two extracellular immunoglobulin domains, a transmembrane domain, and a short cytoplasmic tail. The gamma chain, on the other hand, contains a single extracellular immunoglobulin domain, a transmembrane domain, and a long cytoplasmic tail.

Activity of Recombinant Mouse CD16/FcRIII Protein

Recombinant Mouse CD16/FcRIII Protein is primarily known for its role in mediating antibody-dependent cell-mediated cytotoxicity (ADCC). This process involves the binding of the Fc region of an antibody to the Fc receptor on the surface of natural killer (NK) cells, leading to the activation of these cells and subsequent killing of target cells. CD16/FcRIII is the only Fc receptor expressed on the surface of NK cells, making it a crucial player in ADCC.

Apart from its role in ADCC, Recombinant Mouse CD16/FcRIII Protein also plays a role in immune modulation. It has been shown to regulate the production of cytokines, such as interferon-gamma and tumor necrosis factor-alpha, by NK cells. This modulation of cytokine production is essential for the activation and regulation of immune responses.

Applications of Recombinant Mouse CD16/FcRIII Protein

Recombinant Mouse CD16/FcRIII Protein has a wide range of applications in both basic research and clinical settings. Some of the key applications of this protein include:

1. Study of immune cell function: The use of recombinant CD16/FcRIII protein in in vitro studies has provided valuable insights into the function of NK cells and their role in immune responses. It has also been used to investigate the mechanisms of ADCC and the regulation of cytokine production by NK cells.

2. Development of therapeutic antibodies: The interaction between CD16/FcRIII and the Fc region of antibodies is crucial for the efficacy of therapeutic antibodies. Recombinant CD16/FcRIII protein has been used to screen and select antibodies with high affinity for this receptor, thus aiding in the development of more effective therapeutics.

3. Diagnosis and monitoring of diseases: CD16/FcRIII expression on NK cells has been linked to various diseases, including cancer and autoimmune disorders. The use of recombinant CD16/FcRIII protein in flow cytometry has enabled the identification and monitoring of NK cells in these diseases, providing valuable diagnostic and prognostic information.

4. Immunotherapy: The ability of CD16/FcRIII to activate NK cells and induce ADCC has made it a promising target for immunotherapy. Recombinant CD16/FcRIII protein has been used in the development of novel immunotherapeutic approaches, such as bispecific antibodies, that can activate NK cells and target cancer cells.

Conclusion

In conclusion, Recombinant Mouse CD16/FcRIII Protein is a glycoprotein that plays a critical role in immune modulation and ADCC. Its structure, activity, and diverse applications make it a valuable tool in biomedical research and clinical applications. Further studies on this protein may lead to the development of novel immunotherapeutic approaches and improved understanding of immune cell function.

Recombinant Mouse CD16/FcRIII Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD16/FcRIII Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products