Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Mouse TINAGL1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q99JR5
Molecular weight:
29.51 kDa

Original price was: $280.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Gly227–His466
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Mouse TINAGL1 Protein, N-His

Recombinant Mouse TINAGL1 Protein, N-His

Product name ARO-P10479-100
Uniprot ID Q99JR5
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GSWAFSTAAVASDRVSIHSLGHMTPILSPQNLLSCDTHHQQGCRGGRLDGAWWFLRRRGVVSDNCYPFSGREQNEASPTPRCMMHSRAMGRGKRQATSRCPNGQVDSNDIYQVTPAYRLGSDEKEIMKELMENGPVQALMEVHEDFFLYQRGIYSHTPVSQGRPEQYRRHGTHSVKITGWGEETLPDGRTIKYWTAANSWGPWWGERGHFRIVRGTNECDIETFVLGVWGRVGMEDMGHH
Molecular weight 29.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly227-His466
Aliases /Synonyms TIN Ag-related protein, TINAGL1, OLRG-2, TIN-Ag-RP, LCN7, OLRG2, Oxidized LDL-responsive gene 2 protein, GIS5, TINAGL, Tubulointerstitial nephritis antigen-like, Tubulointerstitial nephritis antigen-related protein, Glucocorticoid-inducible protein 5
Reference ARO-P10479
Note For research use only.
Molecular Constructor
Gly227–His466
Product name ARO-P10479-1MG
Uniprot ID Q99JR5
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GSWAFSTAAVASDRVSIHSLGHMTPILSPQNLLSCDTHHQQGCRGGRLDGAWWFLRRRGVVSDNCYPFSGREQNEASPTPRCMMHSRAMGRGKRQATSRCPNGQVDSNDIYQVTPAYRLGSDEKEIMKELMENGPVQALMEVHEDFFLYQRGIYSHTPVSQGRPEQYRRHGTHSVKITGWGEETLPDGRTIKYWTAANSWGPWWGERGHFRIVRGTNECDIETFVLGVWGRVGMEDMGHH
Molecular weight 29.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly227-His466
Aliases /Synonyms TIN Ag-related protein, TINAGL1, OLRG-2, TIN-Ag-RP, LCN7, OLRG2, Oxidized LDL-responsive gene 2 protein, GIS5, TINAGL, Tubulointerstitial nephritis antigen-like, Tubulointerstitial nephritis antigen-related protein, Glucocorticoid-inducible protein 5
Reference ARO-P10479
Note For research use only.
Molecular Constructor
Gly227–His466
Product name ARO-P10479-50
Uniprot ID Q99JR5
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GSWAFSTAAVASDRVSIHSLGHMTPILSPQNLLSCDTHHQQGCRGGRLDGAWWFLRRRGVVSDNCYPFSGREQNEASPTPRCMMHSRAMGRGKRQATSRCPNGQVDSNDIYQVTPAYRLGSDEKEIMKELMENGPVQALMEVHEDFFLYQRGIYSHTPVSQGRPEQYRRHGTHSVKITGWGEETLPDGRTIKYWTAANSWGPWWGERGHFRIVRGTNECDIETFVLGVWGRVGMEDMGHH
Molecular weight 29.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly227-His466
Aliases /Synonyms TIN Ag-related protein, TINAGL1, OLRG-2, TIN-Ag-RP, LCN7, OLRG2, Oxidized LDL-responsive gene 2 protein, GIS5, TINAGL, Tubulointerstitial nephritis antigen-like, Tubulointerstitial nephritis antigen-related protein, Glucocorticoid-inducible protein 5
Reference ARO-P10479
Note For research use only.
Molecular Constructor
Gly227–His466

Recombinant Mouse TINAGL1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse TINAGL1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products